KEGG   Burkholderia plantarii ATCC 43733: bpln_1g16260Help
Entry
bpln_1g16260      CDS       T04139                                 

Definition
(GenBank) ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
bpla  Burkholderia plantarii ATCC 43733
Pathway
bpla00030  Pentose phosphate pathway
bpla00710  Carbon fixation in photosynthetic organisms
bpla01100  Metabolic pathways
bpla01110  Biosynthesis of secondary metabolites
bpla01120  Microbial metabolism in diverse environments
bpla01130  Biosynthesis of antibiotics
bpla01200  Carbon metabolism
bpla01230  Biosynthesis of amino acids
Module
bpla_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bpla_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    bpln_1g16260
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    bpln_1g16260
Enzymes [BR:bpla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     bpln_1g16260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A Sugar-bind DeoRC
Motif
Other DBs
NCBI-ProteinID: ALK30433
LinkDB All DBs
Position
1:1932876..1933628
Genome map
AA seq 250 aa AA seqDB search
MPNDSGKLAAFAISAFPLSMTQDELKRLVGQAAADYVLANVPEGSVIGVGTGSTANCFID
ALAAIKTRYRGAVSSSIATTQRLEAHGIRVFDLNEIDGLQVYVDGADEIDASGAMIKGGG
GALTREKIVASVSGTFVCIADASKRVATLGAFPLPVEVVPMARTAIGRRLTALGGVPVLR
VKGDGTPYLTDNGNEILDVKGLAITDPRGLEATVNGWPGVVTVGLFAQRGADLCLLGGAA
GVETIDYRGV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacgactccggtaaactcgccgctttcgcaatcagcgctttccccctctccatg
actcaagacgaactcaaacgcctcgtcggccaggcggccgccgactacgtgctggcgaac
gtgccggaaggctcggtgatcggcgtcggcaccggctccaccgcgaactgcttcatcgac
gcgctggccgcgatcaagacacgctaccgcggcgcggtatcgagctcgatcgccaccacg
cagcgcctggaagcgcacggcatccgcgtgttcgacctcaacgagatcgacggcctgcag
gtgtacgtggacggcgccgacgagatcgacgcgagcggcgcgatgatcaagggcggcggc
ggggcgctcacgcgcgagaagatcgtggcctcggtatcgggcaccttcgtctgcatcgcc
gacgcgagcaagcgcgtcgcgacgctcggcgcgttcccgctgccggtggaagtcgtgccg
atggcgcgcaccgcgatcggccgccggctgaccgcgctgggcggcgtgccggtgctgcgc
gtcaagggcgacggcacgccctacctgaccgacaacggcaacgagatcctcgacgtgaag
gggctcgccatcaccgatccgcgtgggctggaagctacggtcaacggctggcccggcgtc
gtcacggtcggtctgttcgcgcagcgcggcgccgatctgtgcctgctcggcggcgcggcc
ggggtggaaacgatcgattatcgcggcgtttaa

DBGET integrated database retrieval system