KEGG   Burkholderia plantarii ATCC 43733: bpln_1g25670Help
Entry
bpln_1g25670      CDS       T04139                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpla  Burkholderia plantarii ATCC 43733
Pathway
bpla00010  Glycolysis / Gluconeogenesis
bpla00020  Citrate cycle (TCA cycle)
bpla00620  Pyruvate metabolism
bpla01100  Metabolic pathways
bpla01110  Biosynthesis of secondary metabolites
bpla01120  Microbial metabolism in diverse environments
bpla01130  Biosynthesis of antibiotics
bpla01200  Carbon metabolism
Module
bpla_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bpln_1g25670
   00020 Citrate cycle (TCA cycle)
    bpln_1g25670
   00620 Pyruvate metabolism
    bpln_1g25670
Enzymes [BR:bpla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     bpln_1g25670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ALK31334
UniProt: A0A0P0KTV4
LinkDB All DBs
Position
1:complement(3020832..3022469)
Genome map
AA seq 545 aa AA seqDB search
MSQAIEVKVPDIGDYKDIPVIEVLVKAGDTVEAEQSLVTLESDKATMDVPSPSAGTVKEV
KVKAGDTVSEGTLIVVFEGSGEAKAEAPKAEAPKAEAAPAKAEAPKAGAPAAGGGTVDVK
VPDIGDYKDIPVIEIGVKVGDKVEKEQSLVTLESDKATMDVPSPAAGTVKEIKVKVGDTV
SEGALIVVLESGDAAPAAAAPKAEAPKAEAPKAAPAQAEQKAAPAAQASAPAPAPAASGR
ASHASPSVRKFARELGVDVGRVAGSGPKGRITKEDVTAFVKGVMTGQTAAPAGAAAPAGG
GELNLLPWPKIDFTKFGPVEAQPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEALR
VQLNKENEKSGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLILKQYFHIGFAADTPNG
LVVPVIRDADKKGLVDIAKEMADLSKAARDGKLKPDQMQGGCFSISSLGGIGGTHFTPIV
NAPEVAILGLSRSAMKPVWDGKQFVPRLTLPMSLSYDHRVIDGAAAARFNAYLASILGDF
RRVIL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacattcccgtc
atcgaggtgctggtgaaggcgggcgacacggtcgaggccgagcagtcgctcgtcacgctc
gagtccgacaaggcgacgatggacgtgccgagcccgtcggccggtacggtcaaggaagtg
aaggtcaaggcgggcgataccgtgtcggaaggcacgctgatcgtcgtgttcgagggctcg
ggcgaagccaaggcggaagcgccgaaggccgaggcgcccaaggcggaagccgcgccggcc
aaggccgaggcgccgaaggccggcgccccggcggcgggcggcggcacggtcgacgtcaag
gtgccggatatcggcgactacaaggacatcccggtcatcgagatcggcgtgaaggtcggc
gacaaggtcgagaaggagcaatcgctcgtcacgctcgaatcggacaaggcgacgatggac
gtgccgagcccggccgccggcaccgtcaaggaaatcaaggtcaaggtcggcgacacggtc
tccgagggcgcgctgatcgtggtgctggagagcggcgatgccgcgccggccgccgcggcc
ccgaaggcggaagcgccgaaggccgaggcgcccaaggcggcgccggcccaggccgagcag
aaggccgcaccggccgcgcaggcttcggcaccggcaccggcgccggccgcgtcgggccgg
gcgagtcacgcttcgccgtcggtgcgcaagttcgcgcgcgagctgggcgtcgacgtcggc
cgcgtggccggttcgggtccgaagggccgtatcacgaaggaagacgtgaccgcgttcgtg
aagggcgtgatgacgggccagaccgcggctccggccggcgctgccgcgccggcgggcggc
ggcgagctgaacctgctgccgtggccgaagatcgacttcacgaagttcggtccggtcgag
gcgcagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgcaactgggtc
atgatcccgcacgtcacgaacaacgacgaggcggacatcaccgagctcgaggcgctgcgc
gtccagctgaacaaggaaaacgagaagtcgggcgtgaagttcacgatgctcgccttcgtg
atcaaggccgtggtcgcggcgctgaagaagttcccgaccttcaacgcgagcctcgacggc
gacaacctgatcctcaagcagtacttccacatcggtttcgccgccgacacgccgaacggg
ctggtcgtgccggtgatccgcgacgcggacaagaagggcctcgtcgacatcgccaaggaa
atggccgatctgtcgaaggcggcgcgcgacggcaagctcaagcccgaccagatgcagggc
ggctgcttctcgatctcgtcgctgggcggcatcggcggcacgcatttcacgccgatcgtc
aacgcaccggaagtcgcgatcctcggcctgtcgcgcagcgcgatgaagccggtctgggac
ggcaagcagttcgtgccgcgcctgacgctgccgatgtcgctgtcttacgatcaccgcgtg
atcgacggcgccgcggccgcgcgcttcaacgcgtacctggcgtcgatcctcggcgatttc
cgccgcgtgattctttga

DBGET integrated database retrieval system