KEGG   Burkholderia plantarii ATCC 43733: bpln_1g29360Help
Entry
bpln_1g29360      CDS       T04139                                 

Definition
(GenBank) Isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bpla  Burkholderia plantarii ATCC 43733
Pathway
bpla00020  Citrate cycle (TCA cycle)
bpla00480  Glutathione metabolism
bpla01100  Metabolic pathways
bpla01110  Biosynthesis of secondary metabolites
bpla01120  Microbial metabolism in diverse environments
bpla01130  Biosynthesis of antibiotics
bpla01200  Carbon metabolism
bpla01210  2-Oxocarboxylic acid metabolism
bpla01230  Biosynthesis of amino acids
Module
bpla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpla_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bpln_1g29360
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    bpln_1g29360
Enzymes [BR:bpla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     bpln_1g29360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALK31702
UniProt: A0A0P0L3J6
LinkDB All DBs
Position
1:complement(3461085..3462341)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIVVPDGGDKITVNEDFSLNVSDQPIIPYIEGDGSGADITPVMLKVVNAAVEKAYG
GRRRIHWMEIYAGEKATRIYGDDVWLPEETLQAVKEYVVSIKGPLTTPVGGGRRSLNVTL
RQELDLYVCLRPVRYFKGVPSPVRAPEKTDMVIFRENSEDIYAGIEWPAGSEQAKKVIRF
LQEEMGVKSIRFPDSSALGVKPVSREGTERLVRKAIQYALDHERKSVTLVHKGNIMKYTE
GAFRDYGYALAQKEFGAELIDGGPWMRLKNPKTGGEIVIKDAIADAFMQQILLRPAEYDV
IATLNLNGDYLSDALAAQVGGIGIAPGANQSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADLIISSMEKSIQQKRVTYDFARLMEGATQVSCSGFGNVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcgtcgtgccggacggcggtgacaagatcaccgtcaacgaggac
ttttcgctcaacgtgtcggaccagccgatcatcccgtacatcgagggtgacggctcgggt
gccgacatcacgccggtgatgctgaaagtcgtgaacgccgcggtcgagaaggcctacggc
ggccgccgccggatccactggatggagatctacgccggcgagaaggcgacgcggatctac
ggcgacgatgtctggctgcccgaggagacgctgcaggccgtgaaggagtacgtggtctcg
atcaaggggccgctgaccacgccggtcggcggcgggcgccgttcgctgaacgtgacgctg
cgccaggagctcgacctctacgtctgcctgcgcccggtgcgctatttcaagggcgtgccc
tcgccggtgcgtgcgccggagaagaccgacatggtgatcttccgcgagaactcggaagac
atctatgccggcatcgagtggccggccggctccgagcaggcgaagaaggtgatccgtttc
ctgcaggaggagatgggcgtgaagtcgatccgcttccccgacagctcggcgctcggcgtc
aagccggtgtcgcgcgagggcaccgagcgcctggtgcgcaaggcgatccagtacgcgctc
gaccacgagcgcaagtcggtgacgctggtccacaagggcaacatcatgaagtacaccgag
ggcgcgttccgtgattacggctacgcgctcgcgcagaaggaattcggcgccgagttgatc
gacggcggcccgtggatgcgcttgaagaatccgaagacgggcggcgagatcgtcatcaag
gacgcgatcgccgatgctttcatgcagcagatcctgctgcgcccggcagaatacgacgtg
atcgccacgctgaacctgaacggcgactatctttccgatgcgctcgccgcgcaggtcggc
gggatcggcatcgcgccgggcgccaaccagtccgattcggtcgcgatgttcgaggcgacc
cacggcacggcgccgaagtacgcgggcaaggattacgtgaaccccggctcggaaatcctg
tctgcggagatgatgctgcgccacctcggctggaccgaggcggccgacctgatcatctcg
tcgatggagaagtcgatccagcagaagcgcgtgacgtatgacttcgcgcggctgatggag
ggcgcgacgcaggtgtcgtgctcgggtttcggcaacgtgctgatcgagaacatgtag

DBGET integrated database retrieval system