KEGG   Burkholderia plantarii: bpln_2g04540Help
Entry
bpln_2g04540      CDS       T04139                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bpla  Burkholderia plantarii
Pathway
bpla00250  Alanine, aspartate and glutamate metabolism
bpla00410  beta-Alanine metabolism
bpla00640  Propanoate metabolism
bpla00650  Butanoate metabolism
bpla01100  Metabolic pathways
bpla01120  Microbial metabolism in diverse environments
Module
bpla_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bpla00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    bpln_2g04540
   00650 Butanoate metabolism
    bpln_2g04540
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    bpln_2g04540
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    bpln_2g04540
Enzymes [BR:bpla01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     bpln_2g04540
Amino acid related enzymes [BR:bpla01007]
 Aminotransferase (transaminase)
  Class III
   bpln_2g04540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALK32718
UniProt: A0A0P0KGI3
LinkDB All DBs
Position
2:complement(571821..573104)
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVMNTGHRHPK
LVKAIAAQLEQFTHTAYQIVPYASYVELAEKIIARAPGSFAKKAAFFTTGAEAVENAVKM
ARAFTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVSVA
DSLKAIDLLFKADIDPKRVAAIIFEPVQGEGGFYAAPADFVRGLRGICDEHGIVLIADEV
QTGFARTGKLFAMQHHDVLPDLTTMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDIIDEERLEARAVALGDKLKAKLLALRPEVPQIVDVRGPGAMVAVEFFK
AGTREPDADFTKRVQARALERGLLLLICGVHSNVIRFLFPLTIQDAVFDEALGILDEVLK
ETVGVAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgatctgcaagcccgcaagaatgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgccgcgcgcgccgagaacgccgaactgtgggacgtcgagggccgc
cgcttcatcgacttcgcggccggcatcgcggtgatgaacacgggccaccgccatccgaag
ctggtcaaggcgatcgccgcgcaactcgagcagttcacgcacacggcctaccagatcgtc
ccctacgcgtcctacgtcgagctggccgagaagatcatcgcgcgcgcgccgggcagcttc
gcgaagaaggccgcgttcttcacgaccggcgccgaagccgtcgagaacgccgtcaagatg
gcgcgcgcgttcaccggccgccccggcgtgatcgcgttcgcgggcggcttccacggccgc
accatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgaacttcgggccg
ttcccgggcgacgtgttccacgcgccctacccgaacgcgctgcacggcgtgagcgtggcc
gactcgctgaaggcgatcgacctgctgttcaaggccgacatcgatccgaagcgcgtggcc
gcgatcatcttcgagccggtgcagggcgaaggcggcttctacgcggcgccggccgatttc
gtgcgcggcctgcgcgggatctgcgacgaacacgggatcgtgctgatcgccgacgaagtg
cagaccggtttcgcgcgcaccggcaagctgttcgcgatgcagcaccacgacgtgctgccc
gacctcaccaccatggccaagagcctcgcgggcggcatgccgctgtcgggcgtggtcggc
cgcgccgacgtgatggacgcggcggcgccgggcggcctcggcggcacctacgcgggcaac
ccgctcgcggtggccgcggcgcacgcggtgctcgacatcatcgacgaggaacggctcgaa
gcgcgcgccgtcgcgctcggcgacaagctcaaggcgaagctgctggcgcttcggcccgag
gtgccgcaaatcgtcgacgtgcgcggcccgggcgcgatggtggccgtcgagttcttcaag
gccggcacgcgggagccggacgcggacttcaccaagcgcgtgcaggcgcgcgcgctcgaa
cgcgggctgctgctgctgatctgcggcgtccattcgaacgtgatccgcttcctgttcccg
ctgacgatccaggacgccgtgttcgacgaagcgctcggcatcctcgacgaagtgctgaag
gaaaccgtcggcgtcgccgcctga

DBGET integrated database retrieval system