KEGG   Burkholderia plantarii ATCC 43733: bpln_2g08260Help
Entry
bpln_2g08260      CDS       T04139                                 

Definition
(GenBank) Major facilitator family transporter
  KO
K08369  MFS transporter, putative metabolite:H+ symporter
Organism
bpla  Burkholderia plantarii ATCC 43733
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpla02000]
    bpln_2g08260
Transporters [BR:bpla02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Others
    bpln_2g08260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 TRI12 MFS_3 OATP
Motif
Other DBs
NCBI-ProteinID: ALK33077
LinkDB All DBs
Position
2:complement(1045906..1047336)
Genome map
AA seq 476 aa AA seqDB search
MSAAAPSASAAPASAAARLERLPFSRYHALICAVIAIAFFFDSVDLGTMTFVLGSIRKEF
GLSTAMAGLVASASFFGMVAGAALAGLLADRFGRRPVFQWSMVLWGAASYLCSTAQSVEA
LIAWRVLLGLGMGMEFPIAQTLLSEFVPAASRGRLIALIDGFWPLGFICAGVVSYFVLPP
LGWRAVFALLAIPAVFVLVVRRVVPESPRWLEHRGRRDEAARVLDRIEARVMRSAGLASL
PAPSRLAGPAVTRGRGAFREIWSGPYRRRTTMVWLLWFFALLGFYGLTSWLGALLQQAGF
AVTQSVLYTVLISLGGVPGFLCAAWLIERRGRKPTTIASLVGGGAMAYVYGQTALHGQSV
ALLIGTGLAMQFFLFGMWAALYTYTPELYGTGARATGSGFASAIGRVGSLIGPYAVGLVL
PRFGQGGVFTLGALSFVVAALAVAWLGIETKGRALEELTGDEGEAAGRRFATGAAD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgccgctgccccttccgcctccgccgcacccgcgagcgccgccgcgcgcctcgaa
cgcctgccgttttcccgctaccacgcgctgatctgcgcggtcatcgcgatcgcgttcttc
ttcgattcggtcgatctcggcacgatgaccttcgtgctcggttcgatccgtaaggagttc
ggattatcgacggcgatggcgggcctcgtcgccagcgcgagcttcttcggcatggtggcg
ggcgcggcgctggcggggctgctggccgaccgcttcggccgccggccggtgttccagtgg
agcatggtgctgtggggcgccgcgtcctatctatgctcgaccgcgcagagcgtcgaggcg
ctgatcgcctggcgcgtgctgctcgggctcggcatgggcatggaattcccgatcgcgcag
acgctgctgtccgaattcgtgcccgccgccagtcgcggccggctgatcgcgctgatcgac
ggcttctggccgctcggcttcatctgcgccggcgtggtgtcgtacttcgtgctgccgccg
ctcggctggcgcgccgtgttcgcgctgctggcgattccggccgtgttcgtgctggtggtg
cgccgcgtcgtgcccgagtcgccgcgctggctcgaacaccgcggccgccgcgacgaggcc
gcgcgcgtgctcgaccggatcgaggccagggtgatgcgctcggccggactcgcctcgctg
ccggcgccgtcgcggctcgccgggccggccgtcacgcgcggccgcggcgcgttccgcgag
atctggagcggcccgtaccggcgccgcacgacgatggtctggctgctctggttcttcgcg
ctgctcggcttctacggcctcacctcgtggctcggcgcgctgctgcagcaggccggcttc
gcggtcacgcagtcggtgctctataccgtgctgatctcgctgggcggcgtgccgggcttc
ctctgcgcggcctggctgatcgagcgccggggccgcaagcccaccaccatcgcctcgctg
gtcggcggcggcgcgatggcctacgtctacggacagaccgcgctgcacggccagagcgtg
gcgctcctgatcggcaccgggctcgcgatgcagttcttcctgttcggcatgtgggccgcg
ctctatacctatacgcccgagttgtacggcaccggcgcgcgcgcgaccggctccgggttc
gcctcggcgatcggccgggtcggctcgctgatcggcccctacgcggtgggcctggtgctg
ccgcggttcgggcagggcggcgtattcacgctcggcgcgctgtcgttcgtggtcgcggcg
ctggcggtggcctggctcgggatcgagaccaaggggcgcgcgctggaggagttgacgggc
gacgagggcgaggcggccgggcgacgcttcgcgacgggggcggccgactga

DBGET integrated database retrieval system