KEGG   Burkholderia plantarii ATCC 43733: bpln_2g09130Help
Entry
bpln_2g09130      CDS       T04139                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bpla  Burkholderia plantarii ATCC 43733
Pathway
bpla00500  Starch and sucrose metabolism
bpla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bpln_2g09130
Enzymes [BR:bpla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     bpln_2g09130
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     bpln_2g09130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: ALK33164
UniProt: A0A0P0KHP5
LinkDB All DBs
Position
2:complement(1163478..1166939)
Genome map
AA seq 1153 aa AA seqDB search
MIREEPLDQLPLDQLPHAPFQPAAGTPRRTTRRAASRAVDPGAAPADPLWYKDAIIYQLH
VKSFFDSNGDGIGDFPGLISKLDYIASLGVDALWLLPFYPSPRRDDGYDIADYRNVHPDY
GTLADVRRFIREAHARGIRVITELVINHTSDQHPWFQRARRAKPGSVHRDYYVWSDSDTK
FAGTRIIFVDSEPSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVLQVMRFWLDLGI
DGLRLDAVPYLVEREGTSNENLPETHAILKTIRATIDAEYPNRMLLAEANQWPEDVQEYF
GDEDECHMAFHFPLMPRIYMSIASEDRFPIIDIMRQTPELAPSNQWAIFLRNHDELTLEM
VTDSERDLLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVVYYGD
ELGMGDNIHLGDRDGVRTPMQWSADRNGGFSRADPEQLVLPPVMGALYGYDAVNVEAQSR
DPHSLLNWMRRILATRRATQVFGRGTLRFLRPENRRILAYLRELPDATPVLCVANLSRAS
QAVELDLSEFAGRVPVEMTSDSPFPAIGELPYLLTFPPYGFLWFQLSATGSEPAWHRPHA
EPLPEYTTLVMRRGDTHPAAELVATLEAEVLPSWLTRRRWFASKDRPLDAVRFDCVTPIP
GEAFQYAELVATVDGREDRYAVPLAPAWGDETSHPLFMRLALARVRRGPTVGYLTDAFAL
PCFAHGVLRRLADPRDVPLADGGTLVFTPEPEPALARYALGDAPEVRWLAAEQSNSSLVI
GEALVLKLVRRVAPGIHPEAEVSRHLTRAGYRNAPALIGEVRRVAADGTPHTVAIVQNFV
DNQGDAWARSLDFLKRAVSDLALAAAATPDAGESAQAALELDTYAAFAGAIGTRLGELHV
VLAAPSDDPAFAPEPATPAHVEGWTADALAMFERAAALLAPRLDELDADAREAAAALLAS
REAIAQAIGTLVPRELGATCMRIHGDFHLGQVLEVNGDAMLIDFEGEPARPLEARRAKSH
PLRDVAGLLRSLSYASAAAQFAIEKAPAPTADLKRTLFDRFGQAAADRFLANYRDACQAA
AEPFVAPGHAERLLMLFLIEKASYELGYEAANRPDWLRVPVVGLAALAAQLLGRPLADPP
HSPDHPAAPEKKQ
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgaagaaccgctcgaccagctgccgctcgaccaactgccgcatgccccgttc
cagccggccgccggcaccccgcgacgcaccacgcgccgcgccgcctcgcgcgccgtcgat
ccgggcgccgcgcccgccgatccgctctggtacaaggacgcgatcatctaccagttgcac
gtgaagtcgttcttcgattcgaacggcgacggcatcggcgacttcccgggcctgatctcg
aagctcgactacatcgcctcgctcggcgtggacgcgctgtggctgctgccgttctatccg
tcgccgcgccgcgacgacggctacgacatcgccgactaccgcaacgtccaccccgactac
ggcacgctcgccgacgtgcgccgcttcatccgcgaggcgcacgcgcgcggcatccgcgtg
atcaccgagctggtgatcaaccacacctcggaccagcatccgtggttccagcgcgcgcgc
cgcgccaagccgggctcggtgcatcgcgactactacgtctggtcggacagcgacaccaag
ttcgccggcacgcggatcatcttcgtcgacagcgagccgtcgaactggacccacgatccg
gtggcgggccagtactactggcaccgcttctactcgcaccagccggacctgaacttcgac
aacccggcggtggtgcgcgaggtgctgcaggtgatgcgcttctggctcgatctcggcatc
gacgggctgcggctcgacgcggtgccgtacctggtcgagcgcgagggcaccagcaacgag
aacctgcccgagacgcacgcgatcctgaagacgatccgcgcgacgatcgacgccgagtat
ccgaaccggatgctgctggccgaggccaaccagtggccggaggacgtgcaggaatacttc
ggcgacgaggacgaatgccacatggcgttccacttcccgctgatgccgcgcatctacatg
tcgatcgcgagcgaggaccgcttcccgatcatcgacatcatgcggcagacgccggaactc
gcgccgagcaaccagtgggcgatcttcctgcgcaaccacgacgagctgacgctggagatg
gtcaccgactccgagcgcgacctgctctggcagacctacgcgagcgaccgccgcgcgcgc
ctgaacctcggcatccggcggcgcctggcgccgctgatggagcgcgaccggcgccgcatc
gagctgatcaactcgctgctgctgtcgatgccgggcacgccggtggtctactacggcgac
gagctcgggatgggcgacaacatccacctcggcgaccgcgacggcgtgcgcacgccgatg
cagtggtcggccgaccgcaacggcggcttctcgcgcgccgatcccgagcaactggtgctg
ccgcccgtgatgggcgcgctgtacggctacgacgcggtgaacgtcgaggcgcagtcgcgc
gatccgcactcgctgctgaactggatgcgccggatcctggccacgcgccgcgccacccag
gtgttcgggcgcggcacgctgcgcttcctgcggcccgagaaccgcaggatcctcgcctat
ctgcgcgagctgcccgacgccacgccggtgctgtgcgtggcgaacctgtcgcgcgcctcg
caggcggtcgagctggacctgtccgagttcgccggccgcgtgccggtggagatgacctcc
gactcgccgttcccggcgatcggcgagctgccctacctgctgaccttcccgccctacggc
ttcctctggttccagctgtcggccaccggcagcgagccggcctggcaccgcccgcacgcg
gagccgctgcccgagtacaccacgctcgtgatgcggcgcggcgatacgcatccggccgcc
gagctggtcgccacgctcgaggcggaagtgctgccgtcgtggctcacgcggcgccgctgg
ttcgcctcgaaggaccgcccgctcgacgcggtgcgtttcgactgcgtgacgccgatcccg
ggcgaggcgttccagtacgccgagctggtggccaccgtggacggccgcgaggatcgctac
gcggtgccgctcgcccccgcctggggcgacgagacctcgcatccgctcttcatgcggctc
gcgctcgcgcgcgtgcggcgcggcccgacggtgggctacctgaccgatgcgttcgcgctg
ccgtgcttcgcgcacggcgtgctgcgccggctcgcggacccgcgcgacgtgccgctcgcg
gatggcggcacgctggtgttcacaccggagccggaaccggcgctggcgcgatacgcgctc
ggcgacgcgcccgaggtgcgctggctggccgccgagcagagcaacagctcgctcgtgatc
ggcgaggcgctggtgctgaaactggtgcggcgcgtggcgcccggcatccatcccgaggcc
gaggtcagccgccacctcacgcgcgccggctaccgcaacgcgccggcgctgatcggcgag
gtgcgccgcgtggcggccgacggcacgccgcacacggtcgcgatcgtgcagaacttcgtc
gacaaccagggcgacgcctgggcgcgctcgctcgatttcctgaagcgcgcggtgagcgat
ctcgcgctcgcggcggcggccacgcccgacgccggcgaatcggcgcaggcggcgctcgaa
ctcgacacctatgccgcgttcgccggcgcgatcggtacccggctcggcgagctgcacgtg
gtgctggccgcgccgagcgacgatccggcgttcgcgcccgaacccgccactccggcccac
gtcgaaggctggaccgccgacgcgctggccatgttcgagcgcgccgcggccctgctcgcg
ccgcgcctggacgagctcgacgccgacgcgcgcgaggccgcggccgcgctgctcgcctcg
cgcgaggcgatcgcgcaggccatcggcacgctggtgccgcgcgaactcggcgccacctgc
atgcggatccatggcgatttccacctcggccaggtactcgaggtcaacggcgacgcgatg
ctgatcgatttcgagggtgagccggcccggccgctcgaggcgcgccgcgccaagtcgcat
ccgctgcgcgacgtggccggcctgctgcgctcgctgtcgtatgcaagcgcggccgcgcag
ttcgcgatcgagaaggcgcccgcgccgacggccgacctcaagcgcacgctgttcgaccgc
ttcgggcaggccgcggccgaccgcttcctcgccaactaccgcgacgcctgccaagccgcc
gccgagccgttcgtggcacccgggcacgccgagcggctgctgatgctgttcctgatcgag
aaggcgtcctacgaactcggctacgaggccgcgaaccgcccggactggctgcgcgtgccg
gtggtcggactcgcggcgctggccgcgcagctgctcggccgcccgctcgccgatccccct
cattcacccgatcaccccgcagcaccggagaaaaaacaatga

DBGET integrated database retrieval system