KEGG   Burkholderia plantarii ATCC 43733: bpln_2g12340Help
Entry
bpln_2g12340      CDS       T04139                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bpla  Burkholderia plantarii ATCC 43733
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    bpln_2g12340
Enzymes [BR:bpla01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     bpln_2g12340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored Thi4 FAD_binding_3 HI0933_like Glutaredoxin DAO AlaDh_PNT_C K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ALK33475
LinkDB All DBs
Position
2:complement(1556033..1557625)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKNQLKSYLDKITRPIELVASLDDGAKSKELIELLNEIGSLSPRVTVVERRDDAE
RKPSFSIGEPGKPTGIRFAGIPMGHEFTSLVLALLQVGGHPLKLDDATIEQIRNLEGDFS
FETYFSLTCQNCPEVVQALNVMALLNPRIRHVAIDGALFQNEVDERQIMAVPTMFVNGEH
FGQGRSSVKEILAKLDTGASARAAKELDKKDVFDVLIVGGGPAGAAAAIYAARKGIRTGV
VAERFGGQVLDTMAIENFVSVQETEGPKFAVALEQHVKQYEVDIMDVQRATALVPGAINE
IRLESGATLKAKSVILSTGARWRELNVPGEREYRNKGVAYCPHCDGPLFKGKHVAVVGGG
NSGVEAAIDLAGIVREVTLIEFGDALRADEVLQRKLRSLKNVTIITSAQTKELLGDGQKV
NGLVYLERTTGETKRIELEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSLPGVF
AAGDVTTVPYKQIVIAVGEGAKASLSAFDYLIRQDVEAPVAAKVGEAVAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccagttgaagtcgtacctcgacaagatcacccgcccg
atcgaactcgtcgcctcgctcgatgacggcgccaagtcgaaggagctgatcgagctgctg
aacgagatcggctcgctgtcgccgcgcgtcaccgtcgtggaacgccgcgacgacgccgaa
cgcaagccgtcgttctcgatcggcgagcccggcaagcccaccggcatccgcttcgcgggt
atcccgatggggcatgaattcacctcgctcgtgctcgcgctgctgcaggtgggcggccat
ccgctcaagctcgacgacgcgacgatcgaacagatccgcaacctcgaaggcgatttttcc
ttcgagacgtatttctcgctgacctgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatggcgctcttgaacccgcgcatccgccacgtggcgatcgacggcgcgctgttccag
aacgaagtggacgaacggcagatcatggccgtgccgaccatgttcgtgaacggcgagcat
ttcggccagggccgcagcagcgtcaaggaaatcctcgcgaagctcgacaccggcgccagc
gcccgggccgcgaaggaactggacaagaaggacgtgttcgacgtgctgatcgtcggcggc
ggcccggccggcgcggcggccgcgatctacgcggcgcgcaagggcatccgcaccggcgtg
gtggccgagcgtttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtctcc
gtgcaggaaaccgaagggccgaagttcgcggtcgcgctcgaacagcacgtcaagcagtat
gaagtcgacatcatggacgtgcagcgcgccaccgcgctggtgccgggggcgatcaacgag
atccgcctcgaaagcggcgcgacgctgaaggcgaagtcggtgatcctctcgacgggtgcc
cgctggcgcgaactgaacgtgccgggcgaacgcgaataccgcaacaagggcgtggcctac
tgcccgcactgcgacggcccgctgttcaagggcaagcacgtggccgtggtgggcggcggc
aactcgggcgtggaagccgcgatcgacctggccggcatcgtccgtgaagtgacgctgatc
gagttcggcgacgcgctgcgcgccgacgaagtgctgcaacgcaagctgcgcagcctcaag
aacgtgaccatcatcaccagcgcgcagaccaaggagctgctcggcgacggccagaaggtg
aacggcctcgtctacctggagcgcacgaccggcgaaacgaagcgcatcgaactggaaggc
gtgttcgtgcagatcggcctggtgccgaacacggaatggctgaagggcacgatcgagctg
tcgaagcacggcgagatcgtggtcgatgcgcgcggcgccacctcgctgccgggcgtgttc
gccgccggcgacgtgaccacggtgccgtacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcctcgctgtcggccttcgattacctgatccgccaggacgtcgaggcgcccgtc
gccgcgaaggtcggcgaagccgtcgccgcctga

DBGET integrated database retrieval system