KEGG   Burkholderia plantarii ATCC 43733: bpln_2g12610Help
Entry
bpln_2g12610      CDS       T04139                                 

Definition
(GenBank) Phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpla  Burkholderia plantarii ATCC 43733
Pathway
bpla00440  Phosphonate and phosphinate metabolism
bpla01100  Metabolic pathways
bpla01120  Microbial metabolism in diverse environments
bpla01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    bpln_2g12610
Enzymes [BR:bpla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     bpln_2g12610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL PEP_hydrolase IspD Ribul_P_3_epim NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ALK33501
LinkDB All DBs
Position
2:complement(1588063..1589748)
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRAARLRRMLTSNELEFLMEAHNGLSAKIVREAGFKAIWGSGLSISAALG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNMRRLVRKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFAGKIKAGKDSQHDPDFSIVARVEALIAGWGMDEALRR
AHAYADAGADAILIHSKLSRPDEILQFAREWGNRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLVRSSAAAMQATAREIFESETLVNVEDRVATVNEIFRLQDADEYSAAERLYLSSS
SRSSNSALVLAASRGSGLEAVTEDRPKVMLPIAGKPLLRWLVDGFKKEGVNDITVVGGYR
ADAIDKSGIKLVVNERHAETGELASLACAAGKISGDTVISYGDLLFRSYILRDLAESDAE
FTVVVDSSLTDSPNQSVHDFALCSAADDRGLFGQKITLRRVASDAGNGAPHGRWVGLLNV
RGAGVERLKAMIATLQARPDFDQLDIPALLNALVEAGEQIAVQYVHGHWRGVNDLDEFRR
AGDFAHGQTPLASGTAVGDAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcccgcgccgcgcggctgcggcgcatgctg
acgagcaacgagctcgaattcctgatggaagcgcacaacggcctgtccgcgaagatcgtg
cgcgaggccggcttcaaggcgatctggggctcgggcctgtcgatctccgccgcgctcggt
gtgcgcgataacaacgaagcgagctggacccaggtggtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
atgcgccgcctggtgcgcaagctcgagcagcgcggcatcgccggcgtctgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgaacgccagccgctcgccgagatc
gacgagttcgcgggcaagatcaaggccggcaaggattctcagcacgatccggacttctcg
atcgtggcgcgcgtcgaggcgctgatcgcgggctggggcatggacgaggcgctgcgccgc
gcgcatgcctacgccgatgccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctccagttcgcgcgcgaatggggcaaccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccatctggtccgctcgtcggccgcggcgatgcaggccaccgcgcgcgag
atcttcgagagcgagacgctcgtcaacgtcgaggatcgcgtggccaccgtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggccgccgagcgcctctacctgtcgtcgtcg
tcgcgctcgtcgaactcggcgctggtgctcgcggcgagccgcggctcgggcctcgaggcc
gtcaccgaggacaggccgaaggtgatgctgccgatcgccggcaagccgctcctgcgctgg
ctggtggacggcttcaagaaggaaggcgtgaacgacatcacggtggtgggcggctaccgc
gccgacgcgatcgacaagtccggcatcaagctggtggtcaacgagcgccacgccgagacg
ggcgagctcgcctcgctggcctgcgcggccggcaagatcagcggcgacaccgtgatctcc
tacggcgacctgctgttccgcagctacatcctgcgcgacctggccgagagcgacgccgag
ttcacggtggtggtggattcgtcgctgaccgattcgccgaaccagagcgtgcatgacttc
gcgctgtgctcggccgccgacgaccgcggcctgttcggccagaagatcacgctgcggcgc
gtggcgagcgacgccggcaacggcgcgccgcacggccgctgggtcggcctcctgaacgtg
cgcggcgcgggcgtcgaacgcctgaaggcgatgatcgcgacgctgcaggcacgccccgac
ttcgaccagctcgacatcccggcgctgctcaacgcgctggtggaagccggcgagcagatc
gcggtgcagtacgtccacggccactggcgcggcgtgaacgacctcgacgaattccgtcgc
gcgggcgacttcgcgcacggccagacgccgctcgcgagcggcacggcggtcggggacgcg
caatga

DBGET integrated database retrieval system