KEGG   Burkholderia plantarii: bpln_2g22020Help
Entry
bpln_2g22020      CDS       T04139                                 

Definition
(GenBank) Putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpla  Burkholderia plantarii
Pathway
bpla00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpla00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    bpln_2g22020
Enzymes [BR:bpla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     bpln_2g22020
Transporters [BR:bpla02000]
 Other Transporters
  Pores ion channels [TC:1]
   bpln_2g22020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: ALK34410
UniProt: A0A0P0KLP7
LinkDB All DBs
Position
2:2843693..2844367
Genome map
AA seq 224 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELGVPYELKRYERDPKTMLAPPALRSVHPLGKSPVLTDDG
ETIAESGAIIEYLLERYDTGSRFAPAPGTPERRRFTYWLHYAEGSAMPPLLLKLVAMRIA
QAPMPFFAKPIARKIAATLQSSFVDPQLRLHLGYIEESLRATGWFVGDAFSAADVQMSFP
LEAAASRADTVAQLPAIRAFLERIHARPAYHRALARGGPYDMAR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccaccatctcaacaattcccgctcgcagcgcgtgctgtggctgctcgaa
gaactcggcgtgccctacgagctgaagcgctacgaacgcgatccgaagacgatgctcgcg
ccgcccgcgctgcgcagcgtgcatccgctcggcaagtcgccggtgctgaccgacgacggc
gagaccatcgccgaatcgggcgcgatcatcgaatacctgctcgaacgctacgacaccggt
tcgcgcttcgctcccgcgcccggcacgcccgagcggcggcgcttcacctactggctgcac
tacgcggaaggctcggcgatgccgccgctgctgctcaagctggtggcgatgcggatcgcc
caggcgccgatgccgttcttcgcaaagccgatcgcgcgcaagatcgcggcgacgctgcag
tcgagcttcgtcgatccgcaactgaggctgcatctcggctatatcgaggaatcgctgcgc
gccacgggctggttcgtcggcgacgcgttcagcgccgccgacgtgcagatgagcttcccg
ctggaggcggccgcctcgcgcgccgataccgtcgcgcaactgccggcgatccgggcgttc
cttgaacggatccatgcgcggccggcctaccatcgcgcgctggcgcgcggcggtccctac
gacatggcacgctga

DBGET integrated database retrieval system