KEGG   Burkholderia plantarii ATCC 43733: bpln_2g26940Help
Entry
bpln_2g26940      CDS       T04139                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
bpla  Burkholderia plantarii ATCC 43733
Pathway
bpla00270  Cysteine and methionine metabolism
bpla00450  Selenocompound metabolism
bpla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    bpln_2g26940
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    bpln_2g26940
Enzymes [BR:bpla01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     bpln_2g26940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALK34888
LinkDB All DBs
Position
2:3412882..3414174
Genome map
AA seq 430 aa AA seqDB search
MAYSNYHKKDLNGRPLHPETQMMSYGYDPFLSEGAVKPPVFLTSTFAFKSAEDGAEFFDI
VSGRKPLPEGEAAGLVYSRFNHPNLEIVEDRLALLDGSEAAVVTSSGMSAISTVFLAFLR
PGDQLVQSVPLYGGTETLISKIFPDWGIGSHAIQNGLAPASIRDALEAAAQKGPVRLVYV
ETPANPTNSLIDLEGMVAEIDAFEQRHGYRPISVCDNTLLGPIFQKPAAHGVDLSIYSLT
KYVGGHSDLVAGGVTGRRALMMKVRSIRSAFGSQLDPHSSWMLLRSMETVVLRMTQATRT
ASQVARWLAGNPHQEVQVFHPEYLTDDAYQDVYRRHCTGAGSTFAFVLNGGRAQAFRFIN
ALHLFKSAVSLGGSESLICHPASTTHSGVSAAQRERDGVSEGLIRISIGLEHGDDLIADL
DHAFQACAKG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattccaactatcacaagaaggacctgaacggtcgcccgctgcatcccgaaacg
cagatgatgtcctacggctacgacccgttcctctccgagggcgcggtcaagccgccggtg
ttcctcacctccaccttcgcgttcaagtcggccgaggacggcgccgagttcttcgacatc
gtctcgggtcgcaagccgctgcccgagggcgaggcggccggcctcgtctacagccgcttc
aatcacccgaacctggaaatcgtcgaggaccggctcgcgctgctcgacggctcggaagcg
gccgtcgtcacctcgagcgggatgtcggcgatctccacggtgttcctcgcgttcctgcgg
cccggcgaccagctcgtgcagtcggtgccgctctacggcggcaccgagacgctgatctcg
aagatcttccccgactgggggatcggctcgcacgcgatccagaacggcctcgcgccggcc
tcgatccgcgacgcgctcgaggcggccgcgcaaaaaggcccggtgcgtctcgtctacgtc
gagacgccggcgaaccccaccaattcgctgatcgatctcgaaggcatggtcgccgagatc
gacgcgttcgagcagcgccacggctatcgtccgatctcggtctgcgacaacacgctgctc
ggcccgatcttccagaagccggccgcgcacggcgtcgatctgtcgatctattcgctgacg
aagtacgtgggcggccacagcgatctcgtggcgggcggcgtgacgggcaggcgcgcgctg
atgatgaaggtgcgctcgatccgcagcgcgttcggctcgcagctcgatccgcattcgtcg
tggatgctgctgcgctcgatggaaacggtggtgctgcgcatgacgcaggccacgcgcacg
gcgagccaggtggcgcgctggctcgccggcaatccgcaccaggaggtgcaggtgttccat
ccggaatacctcaccgacgacgcctatcaggacgtctaccgccgccattgcacgggagcc
ggctcgaccttcgcgttcgtgctgaacggcgggcgcgcgcaggcgttccgcttcatcaac
gcgctgcacttgttcaagtcggcggtcagcctcggcggctcggaatcgctgatctgccat
ccggcctcgaccacgcactcgggcgtgtcggccgcgcagcgcgagcgggacggcgtgtcc
gaggggctgatccgcatctcgatcggcctcgaacacggcgacgacctgatcgccgatctc
gaccacgcgttccaggcgtgcgcgaagggctga

DBGET integrated database retrieval system