KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0741
Entry
BURPS1710b_0741   CDS       T00289                                 

Gene name
nirB
Definition
(GenBank) nitrite reductase (NAD(P)H), large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00910  Nitrogen metabolism
bpm01100  Metabolic pathways
bpm01120  Microbial metabolism in diverse environments
Module
bpm_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BURPS1710b_0741 (nirB)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     BURPS1710b_0741 (nirB)
SSDB
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Pyr_redox Rubredoxin_C NIR_SIR_ferr Pyr_redox_3 DAO NAD_binding_7 AlaDh_PNT_C GIDA NAD_binding_8 Trp_halogenase FAD_binding_2 FAD_binding_3 3HCDH_N
Other DBs
NCBI-ProteinID: ABA50911
UniProt: Q3JW97
LinkDB
Position
I:complement(755876..758320)
AA seq 814 aa
MRKMKLVMVGNGMAGVRTLEELFKLAPDLYDVTVFGAEPHPNYNRILLSPVLAGEQTLEQ
IVLNDYAWYASHGVTLHVGKKIVKIDRVKRVVIADDGTEAAYDRLLLATGSNPFMLPVPG
AQLDGVLGYRDIADTQAMIDAAARHTHAVVIGGGLLGLEAANGLKLRGMDVTVVHLAPTL
LERQLDAKAGGLLRASLEARGLTFLMPKQTQALVGDEHGRVRAVHFKDGGECKADLVVMA
VGIRPNTALAESAGLYCNRGIVVNDTMQTYDPRIYAVGECVSHRGIAYGLVAPLFEQAKV
AANHLAQFGIGRYTGSVTSTKLKVTGIDLFSAGDFLGGDDTEDITLSDPIAGVYKKLVIK
DDRIVGACLYGDTADGAWYFKLLREGRNIADIRETLMFGETSLGDTGHSGATRAMTMADD
AEVCGCNGVCKGTIVSAIKEKGFFTLDDVRRHTKASASCGSCTGLVEQILMSTLGGDYSA
SPKAKPVCGCTDHTHAEVRAAIREHKLLSVPEAMRFLEWRTPNGCSSCRPALNYYCISTW
PHDAKDDPQSRFINERAHANIQKDGTYSVVPRMWGGVTSADELRRIADVVDKYAIPTVKV
TGGQRIDLLGVKKEDLPGVWRDLGMPSGHAYAKALRTVKTCVGSEWCRFGTQDSTLMGQQ
LERALWRMYAPHKVKLAVSGCPRNCAESGIKDVGVIGVDSGWEIYVGGNGGIKTEVAQFF
CKVKTHEEVLEYAGAFLQLYREEGWYLERTVHYLERVGLDHVKARVLGDAENRRALWDRL
QFALKDEPDPWHDTQDAKVDLRQFIPIAVAPADA
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgcggaagatgaagctggtgatggtcggcaacggcatggccggagtgcgcacgctcgaa
gaattgttcaagctcgcgcccgatttgtacgacgtgacggtattcggcgccgaaccgcat
ccgaactacaaccggatcctgctgtcgcccgtgctcgccggcgagcagacgctcgagcag
atcgtcctcaacgattacgcatggtacgcatcgcacggcgtcacgctccacgtcggcaag
aagatcgtgaagatcgatcgcgtgaagcgcgtcgtgatcgccgacgacggcaccgaggcc
gcatacgaccggctgctgctcgcgaccggctcgaacccgttcatgctgcccgttccgggc
gcgcagctcgacggcgtgctcggctatcgcgacatcgcggacacgcaggcgatgatcgac
gccgccgcgcggcacacgcacgcggtcgtgatcggcggcggcctgctcggcctcgaggcg
gcgaacggcctgaagctgcgcggcatggacgtgacggtcgtgcacctcgcgccgacgctg
ctcgagcgccagctcgacgcgaaggcgggcggcctgttgcgtgcgtcgctggaggcgcgc
gggctgacgtttctgatgccgaagcaaacgcaggcgctcgtcggcgacgagcacggccgc
gtgcgcgcggtgcacttcaaggacggcggcgaatgcaaggccgacctcgtcgtgatggcg
gtcggcattcgcccgaacacggcgctcgccgaaagcgcgggcctctattgcaatcgcggg
atcgtcgtcaacgacacgatgcagacctacgatccgcgcatctacgcggtcggcgaatgc
gtgagccaccgcggtatcgcgtacggcctcgtcgcgccgctgttcgaacaggcgaaagtc
gcggcgaaccatctcgcgcagttcggcatcggccgctacacgggctcggtgacgtcgacg
aagctcaaggtcacgggcatcgacctgttctccgcgggcgacttcctcggcggcgacgat
accgaagacatcacgctgtccgatccgatcgcgggcgtctacaagaagctcgtgatcaag
gacgacaggatcgttggcgcgtgcctgtacggcgacacggccgacggcgcgtggtatttc
aagctgctgcgcgaaggccgcaacatcgcggacatccgcgagacgctgatgttcggcgag
acgagcctcggcgacaccggccacagcggcgcgacgcgcgcgatgacgatggccgacgac
gccgaggtgtgcggctgcaacggcgtgtgcaagggcacgatcgtatcggcgatcaaggaa
aaaggcttcttcacgctcgacgacgtgcgcaggcacacgaaggcgtcggcgtcgtgcggc
tcgtgcaccggcctcgtcgagcagatcctgatgtcgacgctcggcggcgactattcggcg
tcgccgaaggcgaagcccgtatgcggctgcaccgatcatacgcatgccgaagtgcgcgcg
gcgatccgcgagcacaagctgctgtcggtgccggaggcgatgcgctttctcgaatggcgc
acgccgaacggctgctcgagctgccgcccggcgctcaactactactgcatcagcacgtgg
ccgcacgacgcgaaggacgatccgcagtcgcgcttcatcaacgagcgcgcgcacgcgaac
atccagaaggacggcacgtattcggtcgtgccgcggatgtggggcggcgtgacgagcgcc
gacgagttgcgccgcatcgccgacgtcgtcgacaagtacgcgatcccgaccgtcaaggtg
acgggcggccagcgcatcgatctgctcggcgtgaagaaggaggacctgcccggcgtgtgg
cgcgacctcggcatgccgagcggccacgcgtacgcgaaggcgctgcgcacggtgaagacc
tgcgtcggctccgaatggtgccgcttcggcacgcaggattcgacgctgatgggccagcag
ctcgaacgcgcgctgtggcggatgtacgcgccgcacaaggtgaagctcgcggtgtccggc
tgcccgcgcaactgcgcggaatcggggatcaaggacgtcggcgtgatcggcgtcgattcg
ggctgggagatctacgtcggcggcaacggcggcatcaagaccgaagtcgcgcaattcttc
tgcaaggtgaagacgcacgaggaggtgctcgaatatgcgggcgcgttcctgcagctgtat
cgcgaggaaggctggtatctcgagcgcaccgtgcactatctcgagcgcgtcggcctcgac
cacgtgaaggcgcgcgtgctcggcgacgccgagaaccgccgcgcgctgtgggacaggctg
cagttcgcgctgaaggacgagccggacccgtggcacgacacgcaggacgcgaaggtcgat
ctgcgccagttcatcccgatcgccgtcgcgcccgccgatgcgtga

DBGET integrated database retrieval system