KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1228Help
Entry
BURPS1710b_1228   CDS       T00289                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00620  Pyruvate metabolism
bpm00680  Methane metabolism
bpm00710  Carbon fixation in photosynthetic organisms
bpm01100  Metabolic pathways
bpm01120  Microbial metabolism in diverse environments
bpm01200  Carbon metabolism
Module
bpm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BURPS1710b_1228 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BURPS1710b_1228 (ppc)
   00680 Methane metabolism
    BURPS1710b_1228 (ppc)
Enzymes [BR:bpm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BURPS1710b_1228 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 FAD-oxidase_C
Motif
Other DBs
NCBI-ProteinID: ABA49199
UniProt: Q3JUW4
LinkDB All DBs
Position
I:complement(1276595..1279852)
Genome map
AA seq 1085 aa AA seqDB search
MPARPPGGLRERPVRSASRSRTAVRFEKASGIRQRVRFAAASPAASFAASSGFIVRRASP
AVRHAPPRRLIAPAVAGPQFPFTRAFPRKSIVKSSGSARATRRNAVSSSSAPAHAEPPAR
RAAKPARKLDGAAARPLAPTNAASAKPQGRTREDKDRPLFEDIRYLGRLLGDVVREQEGD
AVFDVVETIRQTAVKFRREDDKAAAQTLEKMLRKLTPEQTVSVVRAFSYFSHLANIAEDR
HHNRRRRIHALAGSAAQAGTVAYALDKLKQAGDASSKTIKQFFEGALIVPVLTAHPTEVQ
RKSILDAQHDIARLLAERDQPLTARELAHNEALLRARVTTLWQTRMLRDARLTVADEIEN
ALSYYRATFLDELPALYADIEEALAEHGLRARVPAFFQMGSWIGGDRDGNPNVTAATLDE
AISRQAAVIFEHYLEQVHKLGAELSVSNLLVGASDALKALAAASPDQSPHRVDEPYRRAL
IGVYTRLAASARVRLGEGTVPVRSAGRGAAPVRATPYADAEEFAADLRVLTDSLALHHGE
SLATPRLAPLMRAAEVFGFHLASIDLRQSSDIHEAVVAELLARGGVEADYAALPEADKLR
VLLAALADPRPLRSPYLDYSDLAKSELGVLERAHAIRAQFGARAVRNYIISHTETVSDLV
EVLLLQKETGLFEGTLGTPHANARNGLMVIPLFETIADLRNASDIMRAFFALPGVGELLA
HQGHEQEVMLGYSDSNKDGGFLTSNWELYRAELALVDLFDERGIKLRLFHGRGGTVGRGG
GPTYQAILSQPPGTVNGQIRLTEQGEVIASKFANPEIGRRNLETVVAATLEATLAPHSNA
PKQLPAFEATMQTLSDAAMASYRALVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQ
DPKNRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAVAAYLDGAPDAAERGKRVALLKKMN
KTWPFFANLLSNMDMVLAKTDLAVASRYAQLVADKKLRKHVFERIVAEWHRTADALAEIT
GAHARLAANPLLARSIKNRFPYLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAG
LRNTG
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgcccgcccgccgggcgggctgcgcgaacggcccgtccggtccgcgtcaagatcc
cgaacggccgttcggttcgagaaggcatccggcatccgccagcgggtccggttcgccgcc
gcatcgcctgccgcgtcattcgccgcgtcgtccggtttcatcgtccgacgcgcgtcgcca
gccgtgcggcatgcgccgccgcgccgcctgatcgcgcccgctgttgctggaccgcagttc
ccgttcactcgtgctttcccaaggaaatcgatcgtgaagtcttccggatcggcgcgcgcg
acgcgccgcaatgctgtctcgtcctcttccgccccggcgcacgccgagccccccgcccgc
cgcgccgcgaaacccgcacgcaagctcgacggcgccgccgcgcgcccgctcgcgccgacg
aacgccgcatccgcgaaaccgcaaggccgcacgcgcgaagacaaggaccgcccgctcttc
gaggacattcgctatctcggccgcctgctcggcgacgtcgttcgcgaacaggaaggcgac
gccgtgttcgacgtcgtcgagacgattcgccagaccgcggtcaagttccgccgcgaggac
gacaaggccgccgcgcagacgctcgagaaaatgctgcgcaagctcacgcccgagcagacg
gtgagcgtcgtgcgcgcgttcagctatttctcgcacctcgcgaacatcgccgaggaccgc
catcacaaccgccgccgccgcatccacgcgctcgcgggctccgcggcgcaggcgggcacc
gtcgcgtacgcgctcgacaagctcaagcaggcgggcgacgcgtcgtcgaagacgatcaag
cagttcttcgaaggcgcgctgatcgtgcccgtgctcaccgcgcacccgaccgaggtgcag
cgcaagagcattctcgacgcgcagcacgacatcgcgcggctgctcgccgagcgcgaccag
ccgctgaccgcgcgcgagctcgcgcacaacgaggcgctgctgcgcgcgcgcgtgacgacg
ctctggcagacccggatgctgcgcgacgcgcgcctgaccgtcgccgacgagatcgagaac
gcgctgtcgtactaccgcgcgacgttcctcgacgagctgcccgcgctctacgcggacatc
gaggaggcgctcgccgagcacggcctgcgcgcgcgcgtgccggcgttcttccagatgggc
agctggatcggcggcgaccgcgacggcaacccgaacgtcaccgccgcgacgctcgacgag
gcgatcagccgccaggcggcggtgatcttcgagcattacctcgaacaggtgcacaagctc
ggcgcggagctgtccgtgtcgaacctgctcgtcggcgcgagcgacgcgctcaaggcgctc
gccgccgcgtcgccggaccagtcgccgcaccgcgtcgacgagccgtaccgccgcgcgctg
atcggcgtctacacgcggctcgcggccagcgcgcgcgtgcggctcggcgagggcacggtg
cccgtgcgcagcgcgggccgcggcgccgcgcccgtgcgcgcgacgccgtacgcggacgcg
gaggagttcgccgccgatctgcgcgtgctgaccgattcgctcgcgctgcatcacggcgaa
tcgctcgcgacgccgcgcctcgcgccgctcatgcgcgcggccgaggtgttcggcttccat
ctcgcgagcatcgatttgcggcagagctcggacatccatgaagcggtggtcgccgaactg
ctcgcgcgcggcggcgtcgaggccgactacgcggcgctgcccgaagcggacaagctgcgc
gtgctgctcgcggcgctcgcggacccgcggccgctgcgctcgccgtatctcgactactcg
gacctcgcgaaaagcgagctcggcgtgctcgagcgcgcgcacgcgatccgcgcgcagttc
ggcgcgcgcgcggtgcgcaactacatcatttcgcataccgagacagtgagcgatctcgtc
gaggtgctgctgctgcagaaggaaacgggcctcttcgagggcacgctcggcacgccgcac
gcgaacgcgcgcaacggcctgatggtgattccgctcttcgagacgatcgccgacctgcgc
aacgcgtccgacatcatgcgcgcgttcttcgcgctgccgggcgtgggcgagctgctcgcg
caccagggccacgagcaggaagtgatgctcggctattcggacagcaacaaggacggcggc
ttcctcacgtcgaactgggagctctatcgcgcggaactggcgctcgtcgatctgttcgac
gagcgcgggatcaagctgcgcctgttccatggccgcggcggcacggtgggacgcggcggc
ggcccgacctatcaggcgatcctgtcgcagccgcccggcacggtaaacggccagatccgg
ctcaccgagcagggcgaggtgatcgcgagcaagttcgcgaacccggagatcggccggcgc
aatctggagacggtcgtcgccgcgacgctcgaggcgacgctcgcgccgcacagcaacgcg
ccgaagcagttgcccgcgttcgaggcgacgatgcagacgctgtcggacgcggcgatggcg
tcgtaccgcgcgctcgtctacgagacgcccggcttcaccgactacttcttctcgtcgacg
ccgatcaccgagatcgccgagctgaacatcggcagccggcccgcgtcgcgcaagctgcag
gatccgaagaaccgcaagatcgaggacctgcgcgcgattccgtggggcttctcatggggc
cagtgccggctgctgctcaccggctggtacggcttcggcagcgcggtcgccgcgtatctc
gacggcgcgccggacgcggccgagcgcggcaagcgcgtcgcgctgctgaagaaaatgaac
aagacctggccgttcttcgcgaacctgctgtcgaacatggacatggtgctcgcgaagacc
gatctcgcggttgcgtcgcgctacgcgcagctcgtcgccgacaagaagctgcgcaagcac
gtgttcgagcggatcgtcgccgaatggcatcgcacggcggatgcgctcgccgagatcacc
ggcgcgcacgcgcggctcgccgcgaatccgcttctcgcgcgctcgatcaagaaccgcttc
ccgtacctcgatccgctgaaccacctgcaagtcgagctgatcaagcggcaccgcgcgggc
gacacgaacgcgcggctgcggcgcgggatccatctgacgatcaacgggatcgcggccggc
ctgcgcaatacgggctga

DBGET integrated database retrieval system