KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1364
Entry
BURPS1710b_1364   CDS       T00289                                 

Gene name
waaE
Definition
(GenBank) lipopolysaccharide core biosynthesis glycosyltransferase
Organism
bpm  Burkholderia pseudomallei 1710b
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_4 Glyco_tranf_2_3 SGNH Glyco_tranf_2_2
Other DBs
NCBI-ProteinID: ABA50652
UniProt: Q3JUH9
LinkDB
Position
I:complement(1435795..1436559)
AA seq 254 aa
MAEPTLGVALIAYNAAARLAECLSALSFADDVIVVDGGSTDATVDIAKAHGARVIVAADW
PGFGPQKNRAVSALDTDWILSIDTDEIVTPELAASIRAAIRAPRAPVYSLDRLSSFCGTW
VRHSGWYPDWLPRLFKRGAARFSDDLVHERLVFDGPSAKLDGKLLHYSYEDFETVLRKLD
AYSSAGAEQRRAAGKRGGLAKAFGRGAWAFVRTYVLRCGFLDGRAGFMIAVFNAETVYYR
FLKLGLARQRKARD
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcagaacccactctcggcgtcgccctcatcgcctacaacgccgcggcccggctcgcc
gaatgcctcagcgcgctgtcgttcgccgacgacgtcatcgtcgtcgacggcggcagcacc
gacgcaaccgtcgatatcgcgaaagcccatggcgcacgcgtaatcgttgccgccgactgg
ccaggtttcgggccgcaaaagaaccgcgcggtatccgcgctcgacaccgactggatcctg
tcgatcgacaccgacgaaatcgtcacgcccgaactcgccgcgtcgatccgggcggcgata
cgcgcgccacgcgcgccggtctattcgctcgatcggctctcgagcttctgcggcacctgg
gtacgccacagcggctggtaccccgactggctgccgcgccttttcaagcggggcgcggca
cgcttttccgacgatctcgtccatgagcgactcgtgttcgacggaccgtccgcgaaactc
gacggcaagctgctccactattcatacgaagactttgaaaccgtgttgcgcaagctcgat
gcatattcgagcgcaggcgccgaacagcgacgcgcggcgggcaagcgcggcgggttggcg
aaggcattcgggcgtggcgcatgggccttcgtgcgcacctatgtgctgcggtgtggcttc
ctggatggacgggcgggcttcatgatcgccgtgttcaatgccgaaacggtctactaccgc
ttcctgaagctcggccttgcgcggcagcgaaaggcgcgcgattga

DBGET integrated database retrieval system