KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_2240
Entry
BURPS1710b_2240   CDS       T00289                                 

Definition
(GenBank) alkylhalidase
Organism
bpm  Burkholderia pseudomallei 1710b
SSDB
Motif
Pfam: Trp_halogenase FAD_binding_3 DAO Pyr_redox_2 FAD_binding_2 NAD_binding_8 NAD_binding_7 FAD_oxidored HI0933_like GIDA Pyr_redox Thi4 2CSK_N AlaDh_PNT_C Lycopene_cycl 3HCDH_N Pyr_redox_3 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: ABA49400
UniProt: Q3JS18
LinkDB
Position
I:2506924..2508366
AA seq 480 aa
MHLPNRTQVLVIGGGPAGATGAAFLAREGVEVTLVDKEVFPRYHIGESLLPSCLEILTLM
GARDTFDRHGFQRKPGAYFNWKGETWKLDFGELGGTYRYSYQVRREEFDHLLLQHARAVG
AQVHEGVSVREILFDDGRPCAALCVAQGAEEATTVEFDYLVDASGRNGLMSTRYLDNRKF
HEIFRNVAAWGYWEGLSWPDDCAPGSILVSSIPDGWWWAIPLADRPTSVGVVMHRDAFVA
ARRTGTLEQVYAQALALSPVMANLTEHARLVTPLKTEQDYSYTCDSFAGNGYFLSGDAAC
FLDPLLSTGVHLAMYSGMLAAASLASILRAEVTEREAAAYYRDSYRQAYLRFLVFVQTFY
EAHGKLGYYSKADELSHYMIEAGDIRRAFLNLVSGLEDIADAEQATSHLMGEMSRRIDQN
LALRKDKRALLSAIGSTQVEDNARFFDAIEGLPCLSANMALDGLYVSTRPRLGLQRVAAM
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgcatcttccgaatcgcacacaagtcctcgtcatcggcggcggcccggccggcgcgacc
ggcgccgcgttcctcgcgcgcgaaggcgtcgaggtcacgctcgtcgacaaggaggtattc
ccccgctatcacatcggcgaatcgctgttgccgtcctgcctcgaaatcctcacgctgatg
ggcgcgcgcgacacgttcgaccgccacggcttccaacgcaagcccggcgcgtacttcaac
tggaaaggcgagacctggaaactcgatttcggcgagctcggcggcacctatcgctacagc
taccaggtgcgccgcgaggaattcgatcacctgctgctgcagcatgcgcgcgcggtcggc
gcgcaggtgcacgaaggcgtcagcgtgcgcgagattctgttcgacgacggccgcccatgc
gccgcgctgtgcgtcgcgcaaggcgccgaggaggccaccaccgtcgagttcgactacctc
gtcgacgcgtcggggcgcaacggcctgatgtcgacccgctacctcgacaaccgcaaattc
cacgagatcttccgcaacgtcgccgcgtggggctactgggaaggcttgagctggcccgac
gattgcgcgccgggctcgattctcgtcagctcgattcccgacggctggtggtgggcgatc
ccgctcgccgatcgcccgacgagcgtcggcgtcgtcatgcaccgcgacgcgttcgtcgcg
gccaggcgcacgggcacgctcgaacaggtctacgcgcaggcgctcgcgctgagcccggtg
atggcgaacctcaccgagcatgcgcgcctcgtcacgccgctcaagaccgagcaggattat
tcgtacacctgcgattcgttcgcgggcaacggctacttcctgtccggcgacgcggcatgc
tttctcgatccgctgctgtccacgggcgtgcacctcgcgatgtacagcggcatgctcgcc
gccgcgtcgctcgccagcatcctgcgcgccgaggtgaccgagcgggaggccgccgcatac
tatcgcgacagctaccgccaggcgtacctgcgctttctcgtgttcgtgcagacgttctac
gaggcgcacggcaaactcggctactacagcaaggccgacgagctgagccactacatgatc
gaggcgggcgacatccggcgcgcgttcctgaatctcgtgtcgggcctcgaggacatcgcc
gacgccgagcaggccacctcgcacctgatgggcgagatgtcgcgccgcatcgatcagaac
ctcgcgcttcgcaaggacaaacgcgcgcttttgtcggcgatcggcagcacgcaggtcgag
gacaacgcgcggttcttcgacgcgatcgagggcctgccctgcctgtcggcgaacatggcg
ctcgacgggctctacgtatcgacccggcctcggctcggcctgcagcgcgtcgccgcgatg
taa

DBGET integrated database retrieval system