KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3078
Entry
BURPS1710b_3078   CDS       T00289                                 

Gene name
trxB
Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BURPS1710b_3078 (trxB)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BURPS1710b_3078 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 FAD_oxidored GIDA NAD_binding_7 HI0933_like AlaDh_PNT_C Thi4 K_oxygenase NAD_binding_8 AAA_14 Trp_halogenase
Other DBs
NCBI-ProteinID: ABA49067
UniProt: Q3JPQ1
LinkDB
Position
I:3384895..3385857
AA seq 320 aa
MSTPKHAKVLILGSGPAGYTAAVYAARANLSPLLITGIAQGGQLMTTTDVENWPADADGV
QGPELMQRFLAHAQRFNTEIVFDHIHTAKLHEKPIRLIGDSGEYTCDSLIIATGASAQYL
GLQSEEAFMGRGVSACATCDGFFYRGQNVAVVGGGNTAVEEALYLTGIAKKVTVIHRRDK
FRAEPILVDRLLEKEKEGAVEIKWDHVLDEVTGDDSGVSGVRIKHVTTGATEDVAVQGLF
IAIGHKPNTDIFKGQLEMKDGYIITNSGLSGNATGTSVPGVFAAGDVQDHIYRQAITSAG
TGCMAALDAQRYLESLHDHK
NT seq 963 nt   +upstreamnt  +downstreamnt
atgtccacgcccaaacacgcgaaagtcctgattctcggttccggccccgccggctacacg
gcggccgtctacgcggcccgcgcgaacctgtcgcccctcctgatcacgggcatcgcgcaa
ggcggccagctgatgacgacgaccgacgtcgagaattggccggccgacgcggacggcgtg
cagggccccgagctgatgcagcgctttctcgcgcacgcgcagcgcttcaacaccgagatc
gtgttcgaccacatccacacggccaagctgcacgagaagccgatccgcctgatcggcgac
tcgggcgaatacacgtgcgactcgctgatcatcgcgacgggcgcgtccgcgcaatacctc
ggcctgcagtcggaagaggcgttcatgggccgcggcgtgtcggcgtgcgcgacctgcgac
ggcttcttctatcgcggccagaacgtcgcggtcgtcggcggcggcaacacggccgtcgag
gaagcgctctatctgacgggcatcgcgaagaaggtcacggtgatccaccgccgcgacaag
ttccgcgcggagccgatcctcgtcgatcgcctgctcgagaaggaaaaggaaggcgcggtc
gagatcaagtgggaccatgtgctcgacgaggtgacgggcgacgattcgggcgtctcgggc
gtgcgcatcaagcacgtgacgacgggcgcgaccgaggacgtcgcggtgcagggcctgttc
atcgcgatcggccacaagccgaacaccgacatcttcaagggccagctcgagatgaaggac
ggctacatcatcacgaacagcggcctgtcgggcaacgcgacgggcacgagcgtgccgggc
gtgttcgcggcgggcgacgtgcaggaccacatctaccgccaggcgatcacgagcgcgggc
acgggctgcatggcggcgctcgacgcgcagcgctatctcgaaagcctgcacgaccacaag
taa

DBGET integrated database retrieval system