KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0238Help
Entry
BURPS1710b_A0238  CDS       T00289                                 

Gene name
dac
Definition
(GenBank) family S11 unassigned peptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00550  Peptidoglycan biosynthesis
bpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BURPS1710b_A0238 (dac)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpm01002]
    BURPS1710b_A0238 (dac)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpm01011]
    BURPS1710b_A0238 (dac)
Enzymes [BR:bpm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BURPS1710b_A0238 (dac)
Peptidases [BR:bpm01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BURPS1710b_A0238 (dac)
Peptidoglycan biosynthesis and degradation proteins [BR:bpm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BURPS1710b_A0238 (dac)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ABA52518
UniProt: Q3JM06
LinkDB All DBs
Position
II:353920..354921
Genome map
AA seq 333 aa AA seqDB search
MTTEPLSTTVARGSRRAACALLRTPSRLFASLFVSAACAAPNGARAAPAPAPAIQAASWL
VVDADSGKTLGAHNVDARREPASLTKLMTAYVAFDALERDALRWDDTVTVAADDIASVGR
DEARMYLTPGQRVRVRDLMRGLIVASANDAALVLAKRIGGSPAGFATMMNDTARRLGMRD
SHFVSPSGITTPDHYSTAHDLSILAQRLNRDFPAFYTFSSQRHFAYGAFAKTNKNRLLGA
DPSVDGMKTGHTNAAGWCMVVTAKRPVGGARARHRVIAVLLGEPTEKQRLADARALLDQG
FASLGADAPAANAVRRANARPGEHRAQARARML
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgagcctctttcgacaaccgtcgcacgcggcagccgccgcgcggcatgtgcg
ctgctccgcacgccctcgcgcctgttcgcctcgctcttcgtgtccgcggcatgcgccgcg
ccgaacggcgcgcgagccgcgccggccccggcaccggcgatccaggccgcgtcctggctc
gtcgtcgacgccgattccggcaagacgctcggcgcgcacaatgtcgacgcgcgccgcgag
ccggcgtcgctgaccaagctgatgaccgcgtacgtcgcgttcgacgcgctcgagcgcgac
gcgctgcgctgggacgacaccgtcacggtggccgccgacgacatcgcctccgtcggccgc
gacgaggcacgcatgtatctgacgcccgggcagcgcgttcgcgtgcgcgacctgatgcgc
ggcctgatcgtcgcctccgcgaacgacgcggcgctcgtgctcgcgaagcgcatcggcggc
agccccgccggcttcgcgacgatgatgaacgacacggcgcgccggctcggcatgcgcgat
tcgcacttcgtgtcgccgtccggcatcacgacgcccgatcactattcgaccgcgcacgac
ctgtcgattctcgcgcagcgtctgaaccgcgatttcccggcgttctacacgttctcgtcg
caacggcatttcgcgtacggcgcgttcgcgaagaccaacaagaatcgtctgctcggcgcc
gatccgagcgtcgacggcatgaagaccggccatacgaacgcagccggatggtgcatggtc
gtcaccgcgaagcggcccgtcggcggcgcgcgcgcgcggcaccgcgtgatcgcggtgctg
ctcggcgagccgaccgagaagcagcggctcgccgacgcccgcgcgctcctcgatcagggc
ttcgcgtcgctcggcgccgacgcgccggcggcgaacgccgtgcgacgggcgaacgcgcgc
cccggcgagcatcgcgcgcaagcgcgggcgcgcatgctctga

DBGET integrated database retrieval system