KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0393
Entry
BURPS1710b_A0393  CDS       T00289                                 

Gene name
soxA
Definition
(GenBank) putative sarcosine oxidase alpha subunit
  KO
K00302  sarcosine oxidase, subunit alpha [EC:1.5.3.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00260  Glycine, serine and threonine metabolism
bpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BURPS1710b_A0393 (soxA)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase
     BURPS1710b_A0393 (soxA)
SSDB
Motif
Pfam: GCV_T SO_alpha_A3 Fer2_4 GCV_T_C Pyr_redox_2 FAD_oxidored Pyr_redox_3 FAD_binding_2 NAD_binding_8 HI0933_like FAD_binding_3 DAO Pyr_redox GIDA Thi4 AlaDh_PNT_C NAD_binding_7 Lycopene_cycl AdoHcyase_NAD
Other DBs
NCBI-ProteinID: ABA52546
UniProt: Q3JLK1
LinkDB
Position
II:complement(550189..553197)
AA seq 1002 aa
MSQKDRLGAGGRINRAQPLTFTFNGRTYQGFQGDTLASALLANGVHFVARSFKYHRPRGI
VTAGVDEPNAVVQLETGAYTVPNARATEVELYQGLVATSVNAKPSLEHDRMAVMQKLARF
LPAGFYYKTFMWPRNLWPKYEEKIREAAGLGKAPDTLDADRYDKCYAHCDVLVVGGGPTG
LAAAHAAAVNGARVILVDDQRELGGSLLACRAEIDGKPALQWVEKIEAELAKLPDMSILT
RSTAFGYQDHNLVTVVQRLTDHLPVSMRKGTREMIWKVRAKRVILATGAHERPLVFGNND
LPGVMTASAVSAYIHRYGVLPGRVAVVATNNDRGYQCALDLKACGAKVTVVDARASTRGA
LPAVAKRHGITVMSGAAVSAAAGKLRVASVDVVSYANGRSGGKIATLPCDLVAMSGGFSP
VLHLFAQSGGKAHWNDDKACFVPGKPVQAEASVGAAAGEFELARALRLALDAGVAAAKSA
GFAAERPPVPKLAEAVEDALLPLWLASGAEAAVRGPKQFVDFQNDVGAADILLAAREGFE
SVEHVKRYTAMGFGTDQGKLGNINGMAILAQALGKTIPETGTTTFRPNYTPVSFGAFAGR
ELGDFLDPIRKTCVHEWHVEHGAMFEDVGNWKRPWYFPRNGEDLHAAVKRECLAVRNGVG
MLDASTLGKIDIQGPDAVKLLNWVYTNPWNKLEVGKCRYGLMLDENGMVFDDGVTVRLGD
QHFMMTTTTGGAARVLTWLERWLQTEWPDMKVRLSSVTDHWATFAVVGPKSRRVVQKVCK
DIDFANDAFPFMSYRDGTVAGVKSRVMRISFSGELAYEVNVPANAGRAVWEALMDAGAEF
DITPYGTETMHVLRAEKGYIIVGQDTDGSITPFDLGMGGLVAKSKDFLGRRSLTRADTAK
SGRKQFVGLLTDDAQSVLPEGGQIVELDAAARADGTTPMLGHVTSSYYSPILNRSIALAV
VKGGLSRMGERVAVSLANGRRVAATISSPVFYDTEGVRQHVE
NT seq 3009 nt   +upstreamnt  +downstreamnt
atgagccagaaagaccgactcggcgcaggcgggcgcatcaaccgcgcacagccgctcacc
ttcacgttcaacggccgcacgtatcagggcttccagggcgacacgctcgcgtctgcgctg
ctcgccaacggcgtgcacttcgtcgcgcgcagcttcaagtaccaccgtccgcgcgggatc
gtgacggcgggcgtcgacgagccgaacgccgtcgtgcagctcgaaaccggcgcgtacacg
gtgccgaacgcgcgcgcgaccgaggtcgagctgtatcaggggctcgtcgcgacgagcgtg
aacgcgaagccgtcgctcgagcacgaccggatggcggtgatgcagaagctcgcgcgtttc
ctgccggcgggcttctactacaagacgttcatgtggccgcgcaatctgtggccgaagtac
gaggagaagatccgcgaggcggccggcctcggcaaggcgcccgacacgctcgacgccgac
cgctacgacaagtgctacgcgcactgcgacgtgctcgtcgtcggcggcggcccgacgggg
ctcgcggccgcgcatgcggcggccgtcaacggcgcgcgcgtgatcctcgtcgacgatcag
cgcgagctgggcggcagcctgctcgcgtgccgcgcggagatcgacggcaagccggcgctg
caatgggtcgagaagatcgaggcggagctcgcgaagctgcccgacatgagcatcctcacg
cgcagcaccgcgttcggctatcaggatcacaacctcgtgaccgtcgtgcagcggctcacc
gatcatctgccggtgtcgatgcgcaagggcacgcgcgagatgatctggaaggtgcgcgcc
aagcgcgtgatcctcgccacgggcgcgcacgagcggccgctcgtgttcggcaataacgat
ctgccgggcgtgatgaccgcgtcggccgtgtcggcgtacatccatcgctacggtgtgctg
ccggggcgcgtcgcggtcgtcgcgacgaacaacgatcgcggctatcagtgcgcgctcgat
ctgaaggcgtgcggcgcgaaggtgacggtcgtcgatgcgcgcgcgtcgacgcgcggcgca
ttgcccgcggtcgccaagcgccacggcatcacggtgatgagcggcgcggccgtgtcggct
gcggcgggcaagctgcgcgtcgcgtcggtcgatgtcgtctcctatgccaatggccgctcg
ggcggcaagatcgcgacgctgccgtgcgatctggtcgcgatgtcgggcggcttcagcccg
gtgctgcacctgttcgcgcaatcgggcggcaaggcgcactggaacgacgacaaggcctgc
ttcgtgcccggcaagccggtgcaggcggaagcgagcgtcggcgcggcggccggcgagttc
gagctcgcgcgcgcgctgcggctcgcgctcgacgcgggcgtcgccgcggcgaaatcggcg
ggctttgccgccgagcgtccgcccgtgccgaagctcgccgaggcggtggaggacgcgctg
ctgccgttgtggctcgcgagcggcgcagaagcggcggttcgcggtccgaagcagttcgtc
gatttccagaacgacgtcggcgcggccgacatcctgctcgccgcgcgcgaaggtttcgaa
tcggtcgagcacgtgaagcgctacacggcgatgggcttcggcaccgatcagggcaagctc
ggcaacatcaacgggatggcgatcctcgcgcaggcgctcggcaagacgattccggagacg
ggcacgacgacgttccgcccgaactacacgccggtgtcgttcggcgcgttcgcgggccgc
gagctcggcgatttcctcgacccgatccgcaagacctgcgttcacgaatggcatgtcgag
cacggcgcgatgttcgaggacgtcggcaactggaagcggccgtggtacttcccgcgcaac
ggcgaggatctgcacgcggcggtcaagcgcgagtgcctcgcggtgcgcaacggcgtcggc
atgctcgatgcgtcgacgctcggcaagatcgatatccagggcccggacgcggtgaagctg
ctgaactgggtatacacgaacccgtggaacaagctcgaggtcggcaagtgccgctacggg
ctgatgctcgacgagaacggcatggtgttcgacgacggcgtgaccgtgcgcctgggcgac
cagcacttcatgatgacgaccaccacgggcggcgccgcgcgcgtgctcacgtggctcgag
cgctggctgcagacggaatggccggacatgaaggtgcgcctttcgtccgtcaccgatcac
tgggcgacgttcgcggtggtcggcccgaagagccgccgggtcgtgcagaaggtgtgcaag
gacatcgacttcgcgaacgacgcgttcccgttcatgagctatcgcgacggcacggtcgcc
ggcgtgaagtcgcgcgtgatgcgcatcagcttctcgggcgagctcgcgtacgaagtgaac
gtgccggcgaacgcgggccgcgcggtatgggaagcgctgatggacgcgggcgcggagttc
gacatcacgccgtacggcaccgagacgatgcacgtgctgcgcgcggagaagggctacatc
atcgtcggtcaggataccgacggatcgatcacgccgttcgatctcggcatgggcgggctc
gtcgcgaaatcgaaggatttcctcggccgccgctcgctcacgcgcgccgataccgcgaag
agcggccgcaagcagttcgtcggcctgctgaccgacgacgcgcagtctgttttgcccgaa
ggcggccagatcgtcgagctcgatgcggccgcgcgtgcggacggcacgacgccgatgctc
ggtcacgtgacgtcgagctattacagtccgatcctgaaccgctcgatcgcgctcgcggtc
gtgaagggcggattgagccggatgggcgagcgcgtcgcggtctcgctcgcgaacgggcgg
cgtgtcgccgcgacgatttcgagcccggttttctacgacaccgaaggggtacgtcaacat
gtggaatga

DBGET integrated database retrieval system