KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0501
Entry
BURPS1710b_A0501  CDS       T00289                                 

Gene name
ordL3
Definition
(GenBank) oxidoreductase, FAD-binding
  KO
K09471  gamma-glutamylputrescine oxidase [EC:1.4.3.-]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00330  Arginine and proline metabolism
bpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BURPS1710b_A0501 (ordL3)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     BURPS1710b_A0501 (ordL3)
SSDB
Motif
Pfam: DAO Pyr_redox_3 FAD_binding_3 FAD_binding_2 Thi4 NAD_binding_8 HI0933_like Pyr_redox_2 GIDA
Other DBs
NCBI-ProteinID: ABA53491
UniProt: Q3JL93
LinkDB
Position
II:686142..687443
AA seq 433 aa
MQNYYEATVTRTPYPALAERIDTDVCIVGGGLAGLSTALGLVERGVRDIALLDAQTVGFG
ASGRNGGFVFGGYSLDNADLLRTLGPESARALYRLTIDAVELIRARAARYGIDCELVDGG
VILANWFDDPARLCAPRKLMKEAFGVDWEPLDERALRTRLKTDRYRGGLFERNAFHFHPL
KYVLGVAAAAAQGGARIHEHSAARAIRRDGAGFVVATDGGAVRARRVVFAGGGYARGVYP
RIERAVLPIATYVIATEPLGARLADAIACEAAVYDTRFAFDYYRPLADTRILWGGRISVL
ERGPEAIARLLRRDLLRVYPQLRDVAVQFAWGGLMSYARHKMPQIGRDAHGVWHAVGFGG
HGMAPTTVAGEVLAAALAGERPVPDGFARFGLARTFGLAGLAAAQLTYSAYEARDALAAR
RCARAGQPFRQRL
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgcagaactactacgaagccacggtcacgcgcacgccctaccccgcgctcgccgaacgc
atcgataccgacgtgtgcatcgtcggcggcggcctggccggcctgtcgacagccctcggg
ctcgtcgagcgcggcgtgcgcgacattgcgctgctcgacgcgcaaacggtcggcttcggc
gcgtcgggccgcaacggcggcttcgtgttcggcggctatagcctcgacaacgcggacctg
ctgcgcacgctcggccccgagtccgcccgcgcgctctatcgcctgacgatcgacgcggtc
gagctgatccgcgcgcgcgccgcgcgctacggcatcgattgcgaactcgtcgacggcggc
gtgatcctcgcgaactggttcgacgatccggcgcgcctttgcgcgccgcgcaagctgatg
aaggaggcgttcggcgtcgactgggagccgctcgatgaacgcgcactgcgcacgcggctg
aagacggaccgctatcgcggcggcctcttcgagcgcaacgcgttccacttccatccgctg
aagtacgtgctcggcgtcgcggccgcggccgcgcagggcggcgcgcggatccacgagcat
tcggccgcgcgcgcgattcgccgcgacggcgcgggttttgtcgtcgcgaccgacggcggc
gcggtgcgcgcgcgccgcgtggtgttcgcgggcggcggctatgcgcgcggcgtgtatccg
cgcatcgagcgcgcggtgctgccgatcgcgacctacgtgatcgcgaccgagccgctcggc
gcgcggctcgccgacgcgatcgcgtgcgaggcggccgtctacgacacccgcttcgcgttc
gactactaccggccgctcgccgacacgcgaattctgtggggcggccgcatttcggtgctc
gaacgcgggccggaagcaatcgcgcggctgctcaggcgcgacctgctgcgcgtttatccg
caactgcgcgatgtcgccgtgcagttcgcgtggggcgggctcatgagctacgcgcgccac
aagatgccgcagatcggccgcgatgcgcacggcgtctggcacgcggtcggcttcggcggc
cacggcatggcgccgacgacggtggcgggcgaggtgctcgcggcggcgctcgcgggcgag
cggcccgtgccggacggcttcgcgcggttcggcctcgcgcgcacgttcgggctcgcgggg
ctcgccgccgcgcagctcacgtacagcgcgtacgaggcgcgcgacgcgctcgccgcgcgc
cgctgcgcacgcgccggccagccctttcgtcagcgcctttag

DBGET integrated database retrieval system