KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1408
Entry
BURPS1710b_A1408  CDS       T00289                                 

Gene name
lpdA
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00010  Glycolysis / Gluconeogenesis
bpm00020  Citrate cycle (TCA cycle)
bpm00260  Glycine, serine and threonine metabolism
bpm00280  Valine, leucine and isoleucine degradation
bpm00310  Lysine degradation
bpm00380  Tryptophan metabolism
bpm00620  Pyruvate metabolism
bpm00630  Glyoxylate and dicarboxylate metabolism
bpm00640  Propanoate metabolism
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
bpm01120  Microbial metabolism in diverse environments
bpm01200  Carbon metabolism
Module
bpm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpm_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bpm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1710b_A1408 (lpdA)
   00020 Citrate cycle (TCA cycle)
    BURPS1710b_A1408 (lpdA)
   00620 Pyruvate metabolism
    BURPS1710b_A1408 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    BURPS1710b_A1408 (lpdA)
   00640 Propanoate metabolism
    BURPS1710b_A1408 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BURPS1710b_A1408 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    BURPS1710b_A1408 (lpdA)
   00310 Lysine degradation
    BURPS1710b_A1408 (lpdA)
   00380 Tryptophan metabolism
    BURPS1710b_A1408 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpm04147]
    BURPS1710b_A1408 (lpdA)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BURPS1710b_A1408 (lpdA)
Exosome [BR:bpm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BURPS1710b_A1408 (lpdA)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA FAD_oxidored FAD_binding_3 NAD_binding_8 Pyr_redox_3 HI0933_like DAO FAD_binding_2 UDPG_MGDP_dh_N XdhC_C
Other DBs
NCBI-ProteinID: ABA51982
UniProt: Q3JIN8
LinkDB
Position
II:complement(1715298..1716698)
AA seq 466 aa
MSDTKTTTLLVIGGGPGGYVAAIRAGQLGVRTILVERDRLGGTCLNIGCIPSKALIHAAG
EFDKVRGFAGDSPLGIRTQAPAIDIARTVAWKDGIVKKLTGGVGALLKKNGVEVVHGDAR
VVDGKTVDVDTGGGARVRIQCEHLLLAAGSEPVELPAMPFGGNVISSTGALSPGRLPKRL
VVVGAGYIGLELGIAYRKLGVEVSVVEARERILPIYDAELTKPVAASLKRLGVRVLLGHK
VLGLNARGDAVCVQDDAHAQTELAADQVLVTVGRRPRTQGWGLETLQLDRAGAALKIDDM
CRTSMRNVWAIGDLTGEPMLAHRAMAQGEMVAEIVAGKKRHFMPAAIAAICFTDPEVVSA
GLAPDEAERTFGACVSASFPFAANGRALTLESADGFVRVVARRDDHLIVGWQAVGAGVSE
LAAAFSQSLEMGARLEDVGGTIHAHPTLGEAVMEAALRALGHALHI
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgagcgacaccaagacaacgaccctgctcgtgatcggcggcgggccgggcggctatgtc
gccgcgattcgggcggggcagctcggcgtgcgcacgattctcgtcgagcgcgacaggctg
ggcggcacgtgcctgaacatcggctgcattccgtcgaaggcgctcattcacgcggcgggc
gaattcgacaaggtgcgcggcttcgccggcgattcgccgctcggcatccgcacgcaggcg
cccgcgatcgacatcgcgcgcacggtggcgtggaaggacggcatcgtgaagaagctgacg
ggcggcgtcggcgcgctcctgaagaagaacggcgtcgaagtcgtgcacggcgacgcgcgc
gtcgtcgacggcaagaccgtcgacgtcgacacgggcggcggcgcgcgcgtgcggatccag
tgcgagcatctgctgctcgccgcgggctccgagcccgtcgagctgccggcgatgccgttc
ggcggcaacgtgatctcgtcgaccggcgcgttgtcgccgggcaggctgccgaagcggctc
gtcgtcgtcggggcgggctacatcgggctcgagctcggcatcgcgtaccgcaagctcggc
gtcgaggtgagcgtcgtcgaggcgcgcgagcgcatcctgccgatctacgacgcggagctg
acgaagcccgtggccgcctcgctcaagcgcctcggcgtgcgcgtgttgctcggccacaag
gtgctcgggctgaacgcgcgcggcgatgcggtgtgcgtgcaggacgacgcgcacgcgcaa
accgagctcgccgccgatcaggtgctcgtgacggtcggccgccgtccgcgcacgcagggc
tgggggctcgagacgctgcagctcgaccgcgcgggcgccgcgctgaaaatcgacgacatg
tgccgcacgtcgatgcgcaacgtctgggcgatcggcgatctgacgggcgagccgatgctc
gcgcatcgcgcgatggcgcaaggcgagatggtcgccgagatcgtggccggcaagaagcgc
catttcatgcccgccgcgatcgccgcgatctgcttcaccgatcccgaggtcgtctcggcc
gggctcgcgcccgatgaagccgagcgcacgttcggcgcgtgcgtgagcgcgtcgtttccg
ttcgccgcgaacggccgcgcgctgacgctcgagagcgcggacggcttcgtgcgcgtcgtc
gcgcgccgcgacgatcacctgatcgtcggctggcaggcggtgggcgccggcgtgtccgaa
ctcgcggccgcgttctcgcaatcgctcgaaatgggtgcgcgcctcgaggacgtcggtggt
acgattcatgcgcacccgacgctcggagaagcggtgatggaagccgcgcttcgcgcgctc
ggacacgcgttgcacatctga

DBGET integrated database retrieval system