KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1418
Entry
BURPS1710b_A1418  CDS       T00289                                 

Gene name
fprD
Definition
(GenBank) pyridine nucleotide-disulphide oxidoreductase family protein
Organism
bpm  Burkholderia pseudomallei 1710b
SSDB
Motif
Pfam: Pyr_redox_2 Patatin DUF3734 Pyr_redox Pyr_redox_3 Reductase_C NAD_binding_8 DAO K_oxygenase AlaDh_PNT_C 3HCDH_N
Other DBs
NCBI-ProteinID: ABA53175
UniProt: Q3JIM8
LinkDB
Position
II:complement(1727634..1729907)
AA seq 757 aa
MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPAS
ITLHDAAFYAAQRIDIALGVRAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPG
FGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEIAATLQALGLQVTLVERAPGV
MPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVG
VTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVR
QGRIAARNMLGHRLPYRDVSIFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLA
DDVLRAAFTIDRPAVEIAALNDAIRLHVNVAAHKTKLSDPNYPLDKLPVQTILILQGGGA
LGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLP
YESQWREAWLSSYVLSFGVPNFLKPQWSQLGCDADRLRAKWTSFFDATAIEQLIARYVDF
DSLGMSPTRLLIGAVDVETGEPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDG
GVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVEVMLRREEIAYMDRVRNDLRF
EEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIED
YDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgcgtgagttcgactatctgctcgtgggcggcggcatcgcgagcgtcacggcggcgcgg
acgctgcgcggcgaggatgcgtcggcgagcatcgcgatcctctgcggcgagccggtgctg
ccgtatcagcgcccgccgctcagccaggagtggctgatgggggccgtgcagcccgcgagc
atcacgctgcacgacgcggcgttctacgcggcgcaacgcatcgacatcgcgctcggcgtg
cgcgccgagcagctcgatcgcgcgaagcggatcgtgcgcacgtcgagcggcgcgaccttt
cgctacggcaagctgctgatcgcgacgggcgcgagcgcgaaggcgccggcgctgcccggc
ttcgggctcgacggcgtgcacgtgctgcacacgttcgcgcaggcgcaggcgctgaaggac
gcggccgcgcacgcgcgccgcgcgacggtgctgggcggcggctttctcggcgtcgagatc
gccgcgacgctgcaggcgctcggcctgcaggtgacgctcgtcgagcgcgcgcccggcgtg
atgccgtcgctgcgcgcgccggcgctcggcggccatttcgaagcgctttgccgcgcgcgc
ggcatcgatgtgctcacgcgctgcgaggtgcgccgcgtgctcggcgcgcagtgcgtcgag
gcggtcgagacgagcgacggcggcacgcggccgtgcgatctgttcgtggcggcggtgggc
gtcacgccgaactgcggttggctcgacggcagcggcctcgcgctcggcgacggggtcgaa
gtcgatgcattcctgcagacggccgacccggacgtgttcgcggcgggcgacgtcgcgcac
ttcgacgatccgatcttcggcgtgcggcggcggatcgagcactgggacaacgcggtgcgg
cagggccggatcgccgcgcgcaacatgctcggccaccggctgccgtatcgcgacgtgtcg
atcttctacggcagcgtgttcgggctgtcgtacaacctgctcggctatccggtcggcgcg
accgagacgatcgagcgcggcgcgttcgacgaagcctcgtacatgcagctctatctcgcc
gacgacgtgctgcgcgccgcgttcacgatcgaccggccggccgtcgagatcgccgcgctg
aacgacgcgatccggctgcacgtgaacgtcgccgcgcacaagacgaaactgagcgatccg
aactatccgctcgacaagctgccggtgcagacgatcctgatcctgcagggcggcggcgcg
ctcggcgcgttcgagtgcggcgcggtcaaggcgctcgagcagcacggcgtgcgccccgac
gtgatctccgcggtgtcgatcggcgcgttcaacggcgcgatcgtcgcgagccatccgaag
ggcgcgacgaaggcgctcgaggcgttctggcgcgagctgtcgatcgcgctgccgctgccg
tacgaatcgcagtggcgcgaggcgtggctatcgtcgtacgtgctgtcgttcggcgtgccg
aatttcctgaagccgcaatggtcgcagctcggttgcgacgccgatcggctgcgcgcgaaa
tggacgagcttcttcgacgcgacggcgatcgagcaactgatcgcgcgctacgtcgatttc
gactcgctcggcatgagcccgacgcgcctgctgatcggcgcggtcgacgtcgagacgggc
gagccgcgcatcttcgacagctacgtcgatcgcctgagccccgcgcatgtgctcgcgagc
ggcagcctgccgccgggcatgccgtggaccgtcgtcgacggccgcccgtactgggacggc
ggcgtcgtcagcaactcgccgctcgacctcgtgatcgcgcgatgcgggcagatcggcgga
cgcgtgttcatcgtcgatctgttctccggctcgaaggcgctgccgacgaacctcgtcgag
gtgatgctgcgccgcgaggaaatcgcgtacatggaccgcgtgcgcaacgatctgcgcttc
gaggaatacgcgagcgattttcgcgacctcgtggacggcatcctcgcgcacgtcgacgcg
ccgagcgcgaacgaaatccgtcagcagccgctgtacatccggctgatgggcaatcgcgcg
gcgatcgacatcgcgcggatcacgctgaaccgggaagggcggctgtcgttcatcgaggac
tacgatttttcgtcggacgcgatcgcgcaactgcagcagcagggctacgacgcggcgctc
gtcgcgctcgcgaatggccgctcgcggcgccggcgcgggcggcgccgcgcgtga

DBGET integrated database retrieval system