KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1652
Entry
BURPS1710b_A1652  CDS       T00289                                 

Gene name
lpd
Definition
(GenBank) Lpd
Organism
bpm  Burkholderia pseudomallei 1710b
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 NAD_binding_8 FAD_binding_3 FAD_binding_2 2-Hacid_dh_C GIDA DAO
Other DBs
NCBI-ProteinID: ABA51335
UniProt: Q3JHZ4
LinkDB
Position
II:2017502..2019274
AA seq 590 aa
MPPPHRRRRVRCAALGTPREAPRALRSAARADRRAAGARRRARGVMRSVTPPCMPPGEPA
NEARRAWRAVCTFSTSRLAMRASRGAHIAIFIAIAGRRAYHSRAVIPRTRNRGTRIARRI
RSMLQPTKECAMTRRFDAIIIGTGQSGPPLAARLSAAGMKVAVVERGRFGGTCVNTGCIP
TKTLIASAYAAHLARRADEYGVTLGGPVAVDMKKVKARKDQVAARSNRGVEQWVRGLENG
AVYHGHARFESARTVRVGEALLEAERIFIDVGGRALIPPIPGLDQVPYFTNSTMMDVDFL
PEHLIVLGGSYVGLEFGQMYRRFGARVTIVEKGPRLIAREDEDVSHAVREILEGEGIDVR
LDADCLSVRRDGGGIAVGLDCAAGAREVRGSHLLLAVGRVPNTDDLGLEHAGVETDARGY
IRVDEQLRTNVAGIWAMGDCNGRGAFTHTSYNDYEIVAANLLDGDPRKVSDRIPAYAMFI
DPPLARVGLTQAEAARSGRRLLVGTRPMTRVGRAVEKGESLGFMKVIVDADSHAILGASI
LGVTGDEVVHSLLDAMYAKAPYTTISRAMHIHPTVSELVPTLLQDLHPPA
NT seq 1773 nt   +upstreamnt  +downstreamnt
gtgccgccgccgcatcgccggcgtcgcgtgcgatgcgccgcgctcggtacgcctcgtgaa
gcgccccgagcgcttcgaagtgcggcgcgcgcggatcgacgcgccgccggagcgcgtcgc
cgcgcgcgaggcgtcatgcgaagcgtcacgccgccatgcatgccgccgggcgagcccgcg
aacgaggcacgccgcgcttggcgcgccgtttgcacattttccacgagtcgtctcgcgatg
cgcgcctcgcgcggcgcgcacatcgcgattttcatcgcgatcgccggtcggcgcgcttac
catagccgggcggtcatccctcgaacccggaaccggggcacgcggattgctcgccggatc
cgttccatgctgcagcccacgaaggagtgcgccatgactcgacgtttcgatgcgatcatc
atcggcaccggtcaatccggtcccccgctcgccgcccggctctccgccgcgggcatgaag
gtggccgtcgtcgagcgcgggcgcttcggcggcacctgcgtgaacacgggctgcattccg
acgaagaccttgatcgcgagcgcgtacgccgcgcacctcgcgcggcgcgccgacgaatac
ggcgtgacgctcggcggccccgtggcggtcgacatgaagaaggtgaaggcgcgcaaggat
caggtggccgcgcgctcgaaccgcggcgtcgagcaatgggttcgcggtctcgagaacggc
gcggtctaccacgggcatgcgcgcttcgagagcgcgcgcacggtgcgcgtcggcgaagcg
ctgctcgaagccgagcggatcttcatcgatgtcggcgggcgcgcgctgattccgccgatc
ccgggcctcgatcaggtgccgtatttcacgaactcgacgatgatggatgtcgatttcctg
cccgagcacctgatcgttctcggcggcagctacgtggggctcgagttcggccagatgtac
cggcgcttcggcgcgcgcgtgacgatcgtcgagaagggcccgcggctgatcgcgcgcgag
gacgaggacgtgtcccacgcggtgcgcgagatcctggagggcgagggcatcgacgttcga
ctcgacgccgattgcctgagcgtgcgccgcgacggcggcgggatcgccgtcggcctcgat
tgcgcggccggcgcgcgcgaagtgcgcggctcgcacctgctgctcgccgtcgggcgcgtg
ccgaacaccgacgatctcgggctcgagcacgccggcgtcgaaaccgatgcgcgcggctac
atccgggtggacgagcagttgcgcacgaacgtggcgggcatctgggcgatgggcgactgc
aacggccgcggcgcgttcacgcatacgtcgtacaacgattacgagatcgtcgcggcgaat
cttctcgacggcgatccgcgcaaggtgtcggatcgcattccggcctacgcgatgttcatc
gatccgccgcttgcccgcgtcggcctcacgcaggccgaggccgcgcgttcggggcgccgg
ctgctggtcggcacgcgcccgatgacacgcgtcgggcgcgcggtcgagaaaggcgagagc
ctcggcttcatgaaagtgatcgtggacgcggacagccacgcgattctcggcgcgtcgatt
ctcggcgtgacgggcgacgaagtcgtgcattcgctgctcgacgcgatgtacgcgaaagcg
ccgtacacgacgatcagccgcgcgatgcacattcatccgaccgtctcggagctcgtgccg
acgctgcttcaggacctgcatccgcccgcatag

DBGET integrated database retrieval system