KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1689
Entry
BURPS1710b_A1689  CDS       T00289                                 

Gene name
sciS
Definition
(GenBank) SciS protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1710b_A1689 (sciS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_A1689 (sciS)
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_A1689 (sciS)
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: ABA51989
UniProt: Q3JHV7
LinkDB
Position
II:complement(2059856..2063932)
AA seq 1358 aa
MNKFLSFLVSRSFIAFVALLAVALVIWFVGPFVAFGGLTPLAGAGMRVLAIALLLAGVLL
WLAGRPTSIVFVALLCVLIWHASPLLAFGGATPFAAEAVRAIAIALVLAAFALHLAFRLL
QKARTDPDFLKSLLEFGGKQPESPAAGRLVAVNAAIAGAIARLKGMRSGARGLRRLLRGK
RYLYELPWYVTLGSRACGKTSALLNAGLSFPVAAQMPRAAAGLPDHGGSVDWWLTNDAVL
IDTAGHYTRHGTSAHAAPLPPAGPAPHAQPFDAAADARRANGQPAGERHAVAMAAAAPSS
AAFVDERQAQWRQTVDQAEWLGFLRTLRKHRPREPINGALLAVDVATLTSADDNARHAEA
AALRARLADLRAQLGVRFPVYLIVTKTDQLPGFAEYFSALTTEGRAQTWGFTLPYDKETI
ADEGVHARCADELRALAARLAAGVNTRLQEEHDTQRRRRLAALPEEFLVLTRPLGELIDR
VFTDSRYDDTQHHATLRGVYFTSAAQTGGEAAAETRTVARRLAAATGRAPAAAARAAQQE
TSQSFFLHDLLTKIVIPDARLVQPNLRWEYRSRTLSLAAHALALLLFAWVAIGLRVSMGN
NDAYLDALARKTAALASRVDQLYKAPKPEAVPDVLTQARSLSAYPGLDLSAPGSGWRFGL
YTPPGIVAESSRTYDALEDTLLLPRIVTRIEAVLSQAIADRDPKAAYDALRVYLMLYDRA
RFDAAQVEAWVLDDWARTDSAAVFGGRASMIAHVEQLFRGERIVQSPLIRNDALIRQARA
FLDGSNATERLYERAKAAMNKEAPDEFTLLRAVGPQAGTVFTRASGAPLARGVPGLFTFD
GYRRVFDKRLAEFVRTAREDDAWVMGRAYLGDAQKKTAEIANALAGADDPLTDAIRRQYL
IEYAQQWDAFLGDIRTIGGTSLAFDLVVLRSFAAPDSPLERLARAAVHETTLAQPEASAD
RSFLQKASAQLSQQADKALGVRAQERVERELVDNRFAGLREMVTGRADTQTDARPGAPAG
KSGLDAVANLLNDYYTALTVSDDALANNSMPPANDTAAKLKMAAQTMPAPFRSVLTGLAA
QGSREVNRGIGQLLSRQLQATVGDVCRLAIEGNYPFAPDSKRDVGIEDFTRVFAQGGVID
DFFAKTLAPFVDTSTRPWRYKTLPGATEPVEGPDLEPFQHAKAIREVFFGAPGQKQMAWK
ADIRIPELDPTITSLAIDVDGQTALYQHGPVAPFAVSWPGPRGGVHAEITASPRIRPDTS
AVSTDGPWALLRLLQKGRVSGTATPGRTRVTLDFDGRKAVLDLASTGSVANPLTSDVLKT
FRCPGSMPMFSLADTGAPPGLPPGSPAAPTSRVARDGR
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgaacaagttcctgtcctttctggtgtctcgatcgttcatcgcgttcgtcgcgctgctc
gccgtcgcgctcgtcatctggttcgtcggcccgttcgtcgcgttcggcgggctcacgccg
ctcgcgggcgcgggcatgcgcgtcctcgcgatcgcgctgctgctggcgggcgtgctgctg
tggctcgcgggccggccgacgagcatcgtgttcgtcgcgctgctgtgcgtgctgatctgg
catgcgtcgccgctgctcgcgttcggcggcgcgacgccgttcgcggcggaggcggtccgg
gcgatcgcgatcgcgctcgtgctcgcggcgttcgcgctgcaccttgcgttccggctgctg
caaaaggctcgcaccgatccggattttctgaagagcctgctcgaattcggcggcaagcag
cccgaatcgcccgcggccggccgcctggtggcggtcaacgccgcgatcgccggcgcgatc
gcgcgcctgaaaggcatgcgcagcggcgcgcgcggcctgcgccgcctgttgcgcggcaag
cgctatctgtacgaactgccgtggtacgtcacgctcggctcgcgggcatgcggcaagacg
agcgcgctcctgaacgccgggctctcgtttccggtcgcggcgcaaatgccgcgcgcggca
gccgggctgccggatcacggcggctcggtcgactggtggttgaccaacgatgcggtgctg
atcgacacggccggccattacacgcgtcacggcacgtcggcgcacgcggcgccgctgccg
cccgccgggcccgcgccgcacgcccagcccttcgacgcggccgccgacgcgcgccgcgcg
aacggtcagccggcgggcgagcggcacgccgtcgcgatggccgcggcggcgccgtcgagc
gccgcgttcgtcgacgagcggcaggcgcaatggcggcagaccgtcgaccaggccgaatgg
ctgggctttctgcggacgctgcgcaagcatcggccgcgcgagccgatcaacggcgcgctg
ctcgccgtcgacgtcgccacgctcacgagcgccgacgacaatgcgcgccatgccgaggca
gccgcgctgcgcgcgcggctcgccgatctgcgcgcgcaactgggcgtgcgctttcccgtc
tatctgatcgtcacgaagacggaccagttgccgggcttcgccgaatacttcagcgcgctg
accacggagggccgcgcgcagacgtgggggttcacgctgccgtacgacaaggagaccatc
gcggacgaaggcgtccacgcgcgctgcgccgacgagctgcgcgcgttggccgcgcggctc
gccgcgggcgtgaacacccgcctgcaggaagagcacgacacgcagcggcgccgccggctc
gccgcgctgccggaggaatttctcgtgctgacacgcccgctcggcgagctgatcgatcgc
gtcttcaccgattcccgctacgacgacacgcagcatcacgcgacgctgcgcggcgtgtat
ttcacgagcgccgcgcagacgggcggcgaggccgccgccgaaacgcgcaccgtcgcgcga
cgcctcgccgccgcgacgggccgcgcgccggccgcggccgcgcgcgcggcgcagcaggaa
accagccagagcttcttcctgcacgatctgctgacgaagatcgtcattccggacgcacgc
ctcgtccagccgaaccttcgctgggagtatcgctcgcgcacgctgagcctcgccgctcac
gcgctcgcgctgctgctgttcgcgtgggtcgcgatcggcctgcgcgtcagcatgggcaac
aacgatgcctatctcgacgcgctcgcgcgcaagacggcggcgctcgcctcccgggtcgac
cagttgtacaaggcgccgaagcccgaggccgtgcccgacgtgctgacgcaagcccgctcg
ctgagcgcgtacccgggcctcgatctgtccgcgccgggcagcggctggcggttcggcctg
tacacgccgcccggcatcgtcgccgaaagcagccgcacgtacgacgcgctcgaggacacc
ctgctgctgccgcggatcgtcacgcgcatcgaggcggtgctgtcgcaggcgatcgccgat
cgcgatccgaaggccgcgtacgacgcgctgcgcgtctatctgatgctgtacgaccgggcc
cgcttcgatgccgcgcaggtcgaggcgtgggtgctcgacgactgggcgcgaaccgacagc
gcggcggtcttcggcggccgcgcgtcgatgatcgcgcacgtcgagcaactgttccgcggc
gagcgcatcgtgcaatccccgctgatccgcaacgatgcgctgatccgccaggcgcgcgcg
ttcctggacggcagcaacgcgaccgagcggctctacgagcgcgcgaaggcggcgatgaat
aaagaagcgcccgacgagttcacgctgctgcgggccgtcggcccgcaggccggcacggtg
ttcacgcgcgcgagcggcgcgccgctcgcgcggggcgtgccgggcctcttcacgttcgac
ggataccggcgcgtgttcgacaagcggctcgccgaattcgtgcggaccgcgcgcgaagac
gatgcatgggtgatgggccgcgcgtatctcggcgacgctcaaaaaaaaacggctgagatc
gcgaatgcgctcgcgggggccgacgatccgctgaccgacgcgatccgccggcaatatctg
atcgaatacgcgcagcaatgggacgcgtttctcggcgacatccgcacgatcggcggcacg
agcctcgcattcgatctcgtggtgctgcgcagcttcgcggcgccggattcgccgctcgag
cggctcgcgcgcgcggcggttcacgagacgacgctcgcgcagcccgaagcgagcgccgat
cgctcgttcctgcaaaaggcgtccgcccagttgagccagcaggcggacaaggcgctcggc
gtgcgcgcgcaggagcgcgtcgagcgcgagctcgtcgacaatcgcttcgcgggcctgcgc
gaaatggtgacgggccgcgcggacacgcaaacggacgcgcgcccgggcgcgccggccggc
aagagcgggctcgatgcggtcgcgaacctgctgaacgactactacacggcgctgaccgtc
tcggacgacgcgctcgcgaacaacagcatgccgcccgcgaacgataccgcggcgaaactg
aagatggccgcgcagacgatgcccgcgccgtttcgctcggtgctgaccgggctcgccgcg
cagggctcgcgcgaagtgaaccgcggcatcggccagttgctgtcgcggcagttgcaggcg
acggtaggcgacgtttgccgcctcgcgatcgagggcaactatccgttcgcgcccgacagc
aagcgcgacgtcggcatcgaggacttcacgcgcgtgttcgcgcaaggcggcgtgatcgac
gacttcttcgcgaagacgctcgcgccgttcgtcgacacgtcgacgcggccttggcgctac
aagacgctgcccggcgcgaccgaaccggtggagggccccgatctcgaaccgtttcagcac
gcgaaggcgattcgcgaagtgtttttcggcgcgcccggccagaagcagatggcgtggaag
gccgacatccggattcccgaactggacccgacgatcacgagcctcgcgatcgacgtcgac
ggacagacggcgctctatcagcacggccccgtcgcgccgttcgcggtgagctggccgggg
ccgcgcggcggcgtgcacgcggagatcaccgcgagcccgcgcatccggccggacacgtcg
gcggtgtcgacggacggcccatgggcgctgctgcgcctgcttcagaagggacgcgtgagc
ggcacggcgacgcccgggcgcacgcgcgtcacgctcgacttcgacggccgcaaggcggtg
ctcgacctcgcgagcacgggcagcgtcgcgaatccgctgacgagcgacgtgctgaagacg
ttccggtgcccgggctcgatgccgatgttcagtctcgcggacaccggcgcgccgccgggc
ttgccgcccgggagcccggcggcgccgacgtcgcgcgtcgcgcgcgacgggcggtga

DBGET integrated database retrieval system