KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1773Help
Entry
BURPS1710b_A1773  CDS       T00289                                 

Gene name
mrcA
Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00550  Peptidoglycan biosynthesis
bpm01100  Metabolic pathways
bpm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BURPS1710b_A1773 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BURPS1710b_A1773 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bpm01003]
    BURPS1710b_A1773 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpm01011]
    BURPS1710b_A1773 (mrcA)
Enzymes [BR:bpm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BURPS1710b_A1773 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BURPS1710b_A1773 (mrcA)
Glycosyltransferases [BR:bpm01003]
 Polysaccharide
  Bacterial polysaccharide
   BURPS1710b_A1773 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:bpm01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BURPS1710b_A1773 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ABA51356
UniProt: Q3JHM3
LinkDB All DBs
Position
II:2161573..2163714
Genome map
AA seq 713 aa AA seqDB search
MTDHTPHSSPPASPTPPQGPAPKRRRYFRTLAGLVLGAAIAGGAVGTWTLHRIWTALPSV
EPLAVYRPALPLRIFSREGELLAEYGVERREFVPLDRIPPLVRHALLAAEDAQFYTHGAV
DIGGLARATVANVVTGQPGQGGSTITMQVARNFFLTREKVLSRKLAEILMSYKLERAYSK
DKLLELYMNEIYLGERAYGFAAAASVYFGKPLDALTPGEAAVLAGLPKAPSAFNPVVNPA
RATMRRNYVLGRMRALGYLDEAAYRQAADAPIALATTPPPGILAAPYVAERARRMMVERF
HDDAYTLGLDVTTTIAMREQRAADAALARGLAQVGRRDAKDALEGALVSIDAATGDILAL
VGGADFSHNVFDHALQAYRQPGSSFKPFVYSAALEKGMFPGVLIDDTQRTLSRDETGANP
WRPRNFGNHYEGFIPVRRGLMRSKNLVAVSLMQVARPDFVQQHAARFGFEPLRNPASLPL
ALGAGSATPLEVASAYGVFANGGVRMEPRLIESVRQRHGGALFDAQPAPGVRVISARNAF
VMDSMLRDVVAHGTARRAVALKRADAAGKTGTSNGSKDVWFAGYSSGVVSVVWMGYDAPR
SLGRATGSSAALPVWVDYMKTAVDGRGAIERTPPADVALVDGDFVYAEYANGDKCAPSLP
PFVRSPFACGAARGAPADGGAPASAAGAAGAPTPAAVDAAERARVLELFRTED
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacacgccgcactcgtcgccgcccgcctcgccgacgccgcctcaggggccc
gcgccgaagcgccgccgctatttccgcacgctcgcgggcctcgtgctcggcgcggcgatc
gcgggcggcgcggtcggcacgtggacgctgcatcgcatctggacggcgctgccgtctgtc
gagccgctcgccgtctatcgtccggcgctgccgctgcggatcttttcgcgcgaaggcgag
ctgctcgccgaatacggcgtcgagcgccgcgagttcgtgccgctcgaccgcatcccgccg
ctcgtgcggcacgcgctgctcgcggccgaggatgcgcagttctacacgcacggcgcggtc
gacatcggcgggctcgcgcgcgcgacggtggcgaacgtcgtcaccggccagcccgggcag
ggcggcagcacgatcacgatgcaggtcgcgcgcaatttctttctgacgcgcgagaaggtg
ctgagccgcaagctcgccgagatcctgatgtcgtacaagctcgaacgcgcgtacagcaag
gacaagctgctcgagctgtacatgaacgagatctatctcggcgagcgcgcgtacgggttc
gcggcggccgcgtcggtgtacttcggcaagccgctcgatgcgctcacgcccggcgaggcg
gcggtgctcgcgggcctgccgaaggcgccgtccgcgttcaatccggtcgtcaatccggcg
cgggcgacgatgcgccgcaactacgtgctcggccgcatgcgcgcgctcgggtatctggac
gaggccgcgtaccggcaggccgccgacgcgccgatcgcgctcgcgaccacgccgccgccc
ggcatcctcgccgcgccgtacgtcgccgagcgcgcgcgccggatgatggtcgagcgcttc
catgacgacgcctacacgctcggcctggacgtgacgacgacgatcgcgatgcgcgagcag
cgcgcggccgacgcggcgctcgcgcgcgggctcgcgcaggtcggccggcgcgacgcgaag
gacgcgctcgaaggcgcgctcgtgtcgatcgacgcggcgacgggcgacattctcgcgctc
gtcggcggcgcggacttctcgcacaacgtgttcgatcatgcgttgcaggcgtatcggcaa
ccgggttcgagcttcaagccgttcgtctattcggccgcgctggagaaagggatgttcccc
ggcgtgctgatcgacgacacgcagcgcacgctgtcgcgcgacgaaaccggcgcgaacccg
tggcggccgcgcaatttcggcaaccactacgaaggcttcattccggtgcggcgcgggctg
atgcgctcgaagaacctcgtcgcggtgagcctgatgcaggtcgcgcggccggatttcgtc
cagcagcacgcggcgcgcttcggcttcgagccgctgcgcaaccccgcgtcgctgccgctc
gcgctcggcgcgggctcggcgacgccgctggaggtggcgagcgcctacggcgtgttcgcc
aacggcggcgtgcgcatggagccgcgcctcatcgaatcggtgcggcagcggcacggcggc
gcgctgttcgacgcgcagcccgcgcccggcgtgcgcgtcatctcggcgcgcaacgcgttc
gtgatggacagcatgctgcgcgacgtcgtcgcgcacggcaccgcgcgccgcgcggtcgcg
ctcaagcgcgcggacgcggcgggcaagaccggcacgtcgaacggctcgaaggacgtgtgg
ttcgccggctactcgtcgggcgtcgtatcggtcgtctggatgggctacgacgcgccgcgc
agcctcggccgcgcgacgggctcgtcggccgcgctgcccgtgtgggtcgactacatgaag
accgcggtcgacggccgcggcgcgatcgagcgcacgccgcccgcggacgtcgcgctcgtc
gacggcgatttcgtctatgccgaatacgcgaacggcgacaagtgcgcgccgtcgctgccg
ccgttcgtgcgcagcccgttcgcgtgcggcgcggcgcgcggtgcgccggcggacggcggc
gcgccggcgagcgcggcaggggcggcgggtgcgccgacgccggccgccgtcgacgcggcc
gagcgcgcgcgcgtgctcgagctgtttcgcaccgaagactga

DBGET integrated database retrieval system