KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1890
Entry
BURPS1710b_A1890  CDS       T00289                                 

Definition
(GenBank) Pyridine nucleotide-disulphide oxidoreductase
  KO
K22549  D-hydroxyproline dehydrogenase subunit alpha [EC:1.5.99.-]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00330  Arginine and proline metabolism
bpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BURPS1710b_A1890
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     BURPS1710b_A1890
SSDB
Motif
Pfam: Pyr_redox_2 FAD_oxidored FAD_binding_2 NAD_binding_8 Thi4 HI0933_like GIDA FAD_binding_3 NAD_binding_9 DAO AlaDh_PNT_C Lycopene_cycl Pyr_redox_3 Fer2_BFD 2-Hacid_dh_C Pyr_redox XdhC_C 3HCDH_N Amino_oxidase TrkA_N ThiF Ribosomal_S11
Other DBs
NCBI-ProteinID: ABA53337
UniProt: Q3JHA6
LinkDB
Position
II:2304914..2306251
AA seq 445 aa
MPDALPRGHAGGAHAMTNEILTVDVAIVGAGPAGLAAARAAARSGCTVAIVDDNPRAGGQ
VWRHGPHAAPGALARASFGVLRQPNVRHLAATRVVAAPRPGALLVEDEQRALVLGYRKLI
LCCGARELLLPFAGWTLPGVTGAGGLQALVKGGAPVRGERVVIAGSGPLLIASLATARAA
GARVVALVEQAPPGALARFALSLAATPSKLAQAARLTRGFVGTRYLTGAVVREAHGDARV
RAVTIEQGGARETLDCERLACGFGLVPNLTLALALGCAVRERAIAVDDAQRTSVEHVYAA
GECTGVGGVELARIEGELAGLAAGGAHAAPHGRARMAALLRRRARWRRFAARVARTFALR
DAARALPPDDTLLCRCEDVTIGAVRAHASARDAKLLTRCAMGACQGRVCGAAAHAYFGWD
DAPPRPPFSPARIDTLLAASDDALL
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgccagacgctctgccgcgagggcatgcaggtggagcgcacgcgatgacgaacgagatt
ttgacggtcgacgtcgcgatcgtcggcgcggggccggcgggcctcgccgccgcgcgcgcg
gcggcgcgcagcggctgcacggtcgcgatcgtcgacgacaacccgcgcgccggcggacag
gtgtggcgacacgggccgcacgccgcgcccggcgcgctcgcgcgcgcgagcttcggcgtg
ctgcggcagccgaacgtgcgccatctggcggctacacgcgtcgtcgccgcgccgcggccc
ggcgcgctgctcgtcgaggacgagcagcgcgcgctcgtgctcggctaccggaagctgatt
ctgtgctgcggcgcgcgcgagctgctgctgccgtttgccggctggacgctgcccggcgtg
acgggcgcgggcggcttgcaggcgctcgtcaagggcggcgcgccggtgcgcggcgagcgt
gtcgtgatcgcgggcagcggcccgcttctgatcgcctcgctcgccaccgcgcgcgcggcg
ggcgcgcgggtcgtcgcgctcgtcgagcaggcgccgcccggcgcgctcgcgcgcttcgcg
ctgtcgctcgcggcgacgccgtcgaagctcgcgcaggccgcgcggctcacgcgcggcttc
gtcggcacgcgctatctgacgggcgcggtcgtgcgcgaggcgcacggcgacgcgcgcgtg
cgcgcggtcacgatcgagcagggcggcgcgcgcgagacgctcgattgcgagcgtcttgcc
tgcggcttcggcctcgtgccgaacctgacgctcgcgctggcgctcggctgcgcggtgcgc
gagcgtgcgatcgcggtcgacgacgcgcagcgaacgtcggtcgagcatgtgtacgcggcg
ggcgaatgcacgggcgtcggcggcgtcgagctcgcgcggatcgagggcgagctcgccggg
ctcgcggcgggcggcgcgcacgccgcgccgcacggccgcgcgcgcatggccgcgttgctg
cgccgccgcgcgagatggcggcgcttcgcggcgcgcgtcgcgcgcacgttcgcgctgcgc
gacgcggcccgcgcgctgccgcccgacgatacgctgctgtgccgctgcgaggacgtgacg
atcggcgcggtgcgcgcgcatgcgtcggcgcgcgacgcgaagctgctcacgcgctgcgcg
atgggcgcgtgccaggggcgcgtatgcggcgcggccgcgcacgcgtatttcggctgggac
gacgcgccgccgcgcccgccgttctcgcccgcgcgcatcgacacgctgctcgccgcgtcc
gacgacgcgctcctataa

DBGET integrated database retrieval system