KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A2517
Entry
BURPS1710b_A2517  CDS       T00289                                 

Definition
(GenBank) Pyridine nucleotide-disulphide oxidoreductase, putative
Organism
bpm  Burkholderia pseudomallei 1710b
SSDB
Motif
Pfam: Pyr_redox_2 FAD_binding_2 FAD_oxidored DAO HI0933_like GIDA Lycopene_cycl NAD_binding_9 NAD_binding_8
Other DBs
NCBI-ProteinID: ABA52436
UniProt: Q3JFI6
LinkDB
Position
II:3033728..3034639
AA seq 303 aa
MNFDVVIIGGSFAGQAAALQLARARRGVLLIDAKRPRNRFARTSHGFLGQDGHAPSAINA
TAGRQLAAYPTVQFDAGDAIDAAAVSDGFRVSLADGRQAQGRRLILATGVRDILPVLPGL
QERWGVSVLHCPYCHGYELERRPMGVLASSEQAVHQAMLVSDWGPTTLFTQGAFVPTREQ
SAMLSARGVTVEQTPVAALVGAAPALEAVCLADGRTAALCGLFIAPRTVPACDLPERLGC
VFDDGPTGPYLSVDERQQTSVPGVFAAGDVARPMANATLAAAAGVIAAAGAHHSLIYGAG
ERG
NT seq 912 nt   +upstreamnt  +downstreamnt
gtgaatttcgatgtcgtcattatcggaggcagctttgccgggcaggcggcggccctccaa
ctggcccgcgcgcgacgcggggtcttgctcatcgacgcgaagcgcccgcgcaatcgcttt
gcgcggacgtcccacggctttctcgggcaggatggccacgcgccgtccgcgatcaacgca
accgcgggccggcagctcgccgcatatcccacggtgcaattcgacgcgggcgatgcgatc
gacgccgcagccgtcagcgacgggtttcgcgtttcgctggctgacggccggcaagcgcag
ggcaggcgtctgatcctggcgacgggcgttcgggacatcctgcctgtgctgcccggcctt
caggagcgctggggcgtcagcgtcctgcactgtccgtattgccacggctacgaactggaa
cggcggccgatgggcgtgctggcaagcagcgagcaggccgtgcatcaggcaatgctggta
tcggactgggggccgaccacgctgttcactcagggcgcgttcgttcccacgcgcgagcag
tcggccatgctgtcggctcgcggcgtgacggtcgagcaaacgccagttgcggcgctcgtc
ggcgccgcgcccgcgctcgaggcggtctgtctcgccgatggtagaacggcggcgctctgc
ggcctgttcatcgcgccccgaacggttccggcctgcgatctgcccgagcggctcggttgc
gttttcgacgacggaccgacggggccctatctttccgtcgacgaacggcagcagacgtcg
gtgcccggcgtgttcgccgcgggggatgtcgcgcggccgatggcgaatgcgacgttggcc
gccgccgcgggcgtgatcgcggcagcgggcgcgcatcattcgctgatctatggtgcgggc
gagcgcggctga

DBGET integrated database retrieval system