KEGG   Brachyspira pilosicoli 95/1000: BP951000_0211Help
Entry
BP951000_0211     CDS       T01278                                 

Gene name
glgP
Definition
(GenBank) alpha glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00500  Starch and sucrose metabolism
bpo01100  Metabolic pathways
bpo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BP951000_0211 (glgP)
Enzymes [BR:bpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     BP951000_0211 (glgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ADK30218
UniProt: D8IAN7
LinkDB All DBs
Position
complement(232009..234555)
Genome map
AA seq 848 aa AA seqDB search
MVSPSVPKELEPLMEITKNFWWVWNQKAINLLRNIDIDNWDKKDHNPIRLLGESSQECFD
TMLHDDAAMMNLAEVYDEFKTYMNQETWYDSLDDSQKTKNEKIAYFSFEYGLHESLPNYS
GGLGILSGDHLKSASDLGLPFVAVGLLYRKGYFRQYLNADGWQQEYDIENDFFNLALEKV
LDKNGETMKVDVDLPGRKVYAQIWKANVGRIELYYLDANIEENSVEDRDITAQLYGGNLE
TRIQQEILLGIGGIKALNKLGIKPTIYHMNEGHSAFLSLERMRQLMENNHLDKNAAREVV
YSSNVFTTHTPVPAGNDVFPIDMVQKYFSEYVKHIGMSMDEFLRLGRINPDDNKENFCMT
VLALNLSAENNGVSLLHGHVSRAMWKDIWKGVPEDELPIDAITNGIHTLSWISFDMQNLL
DRYLGPRWRTKPLEHEVWERVQRIPDAELWKTHERRKERLIDFCRTRLKSQITNRGFTKN
EIEHADQILSPDALTIGFARRFATYKRGTLLFRDLDRLKKILSNKDKPVQIIFAGKAHPH
DNGGKELIREISEICRREDFRDHIVFLEDYDINVARYMVQGVDVWLNNPRRPLEASGTSG
MKVPPNGGLNFSVLDGWWDEAYDAQNGWAIGNREQYSDLEYQDDVESKAIYNVLENEIIP
LYYNNRGRDDIPREWVAAMKWSMQTVCPVFSTNRMVADYYNKFYNKASKRYLHMIKNDFE
KPKALKEWKQNIYDKWSKVSFENTISEMPSRNLKVGSKFEIKTIVNLGDIAPDSVRVELY
YGKLSMKEEIIEPSIIEMKHSADLGNGRHSFSGALVCNNSGQSGFAIRMYPYNKDLSYKF
DMKLIIWS
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaccttctgtgccaaaagagttagaaccattgatggagataactaaaaacttt
tggtgggtttggaatcagaaagcaattaatttgttgaggaacatagatattgacaactgg
gacaaaaaagaccataatcctataagacttttaggagaatcttcacaagaatgtttcgat
actatgcttcatgatgatgcggctatgatgaacttagctgaagtttatgatgagtttaag
acatatatgaatcaagaaacttggtatgatagtttagatgattctcaaaaaactaaaaat
gaaaagattgcgtatttttcttttgaatatggattgcatgaatctttgcctaattattcc
ggcggtttaggaatattatctggagaccatttaaagtctgctagtgatttaggtttgcct
tttgttgctgttggacttttatatagaaaaggttattttagacagtatttaaatgctgat
ggttggcagcaggaatatgatatagaaaatgacttttttaatttagcattagaaaaggtt
ttagataaaaacggcgagacaatgaaagttgatgttgatttgcctggaagaaaagtttat
gctcaaatttggaaggctaatgttggaagaatagagctttattatttagatgctaatata
gaagaaaatagtgtagaagacagagatattacagctcagctttacggcggtaatttagag
actagaatacagcaagagatacttcttggtattggcggtattaaggcattaaacaaactt
ggtattaagcctactatttatcatatgaatgaaggacatagtgcttttctttctttagag
agaatgagacagcttatggaaaataatcatcttgataagaatgcggcaagagaggttgtt
tatagttctaacgtatttacaacacatacacctgtacctgctggtaacgacgtatttcct
atagatatggtacagaaatatttcagcgagtatgttaagcatattggcatgtctatggac
gagttcttaagacttggaagaattaaccctgatgacaataaagaaaatttctgtatgaca
gttttagcacttaatttatctgctgaaaataacggcgtaagcttgcttcatggtcatgtt
tcgagagctatgtggaaagatatatggaaaggagttccagaagatgagcttcctattgat
gctattactaatggtattcatacattaagctggatttcttttgatatgcaaaacttatta
gatagatatttaggtcctcgttggagaactaagcctttagagcatgaggtttgggaaaga
gtacaaagaatacctgatgctgaactttggaaaactcatgagagaagaaaagagagatta
attgatttctgcagaactagattaaaatctcaaattacaaatagaggctttacaaaaaat
gaaatagagcatgctgaccaaatattgtcgcctgatgctttaactattggttttgcaagg
agatttgctacatataaaagaggaactttattatttagagatttagatagattaaagaag
atattgagcaataaagataaaccagtacagataatatttgctggtaaggcacaccctcat
gataatggcggtaaagagcttattagagagatatctgaaatttgcagaagagaagatttt
agagatcatatagtatttttagaagactatgatattaatgtagcaagatatatggttcag
ggtgtagatgtatggcttaataacccaagaagacctttagaagctagcggtacaagcggt
atgaaagttccgcctaatggtggtttgaacttcagcgtattagatggttggtgggacgaa
gcttatgatgctcaaaatggttgggctattggtaatagagagcagtattcagatttagag
tatcaagatgatgttgaaagtaaagctatatataatgtattagaaaatgagattattcct
ctttattataataacagaggaagagatgatatacctcgtgaatgggttgctgctatgaaa
tggagtatgcaaactgtttgtcctgtgttctctacaaatagaatggttgctgattattat
aataagttctataataaagcaagcaaaagatatttgcatatgattaaaaatgactttgaa
aagcctaaggcattaaaagaatggaagcaaaatatatatgataaatggtctaaggtttct
tttgaaaatactatttctgagatgccttcaagaaatttaaaagttggaagcaaatttgaa
ataaaaactatagtaaatcttggagatatagcacctgattctgtgagagttgagctttat
tatggtaaattaagcatgaaagaagagattatagagccttctataattgaaatgaaacat
tctgctgatttaggtaatggaagacattcatttagcggagctttagtatgtaacaatagc
ggacagagcggttttgctataagaatgtatccatacaataaagatttgagttacaaattt
gatatgaagcttattatttggagctaa

DBGET integrated database retrieval system