KEGG   Brachyspira pilosicoli 95/1000: BP951000_1240Help
Entry
BP951000_1240     CDS       T01278                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00473  D-Alanine metabolism
bpo00550  Peptidoglycan biosynthesis
bpo01100  Metabolic pathways
bpo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BP951000_1240 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BP951000_1240 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BP951000_1240 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpo01011]
    BP951000_1240 (ddl)
Enzymes [BR:bpo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BP951000_1240 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bpo01011]
 Precursor biosynthesis
  Amino acid ligase
   BP951000_1240 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATP-grasp CPSase_L_D2 RimK GARS_A ATPgrasp_Ter RRF KAR
Motif
Other DBs
NCBI-ProteinID: ADK31229
UniProt: D8IDK6
LinkDB All DBs
Position
1361459..1362430
Genome map
AA seq 323 aa AA seqDB search
MLLTNELKNKILKKFEGKKIAVLHGGISDEREVSLRSGKNVFEALTSYKELKDSTILIDV
KDHYELVEILKKENVEYCYNILHGTFGEDGTIQGLLDCLNIKYTGENTLVSSLCMNKVYT
KRIWLSSNISTVDFQLLEDAVKNNNISFNFPIILKPISSGSSVGVSLIKTKEEFDNIVKD
IKDIHNYFLEPYIKGKEVTVGLVRDNDDIYVFPILGINPKNEIYDYDAKYTPGKTEMEIP
AKLDKDIEKKLIENCKKAYDVLGCEGLCRIDAIISDDGFINLMEVNTQGGMTNTSDIPAM
ARNINMPFEDVVLYILSLSYRNV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgctattaactaatgaattaaaaaataaaatattaaaaaaatttgaaggaaaaaaaata
gctgtgcttcatggaggcataagcgatgagagggaagtttctcttagaagcggtaagaat
gtttttgaggctttaacttcttataaagaattaaaagacagcacaatattgatagacgta
aaagaccattatgagttggttgaaattctaaaaaaagaaaatgttgaatattgttataat
atattgcatggtacttttggagaagacggtactattcaaggtcttttggattgtcttaat
attaaatatacaggcgaaaatactttggttagctcactttgtatgaataaggtttataca
aaaagaatatggctttcttcaaacatttctactgtagattttcagcttcttgaagatgct
gtaaaaaacaataatatatcttttaatttccctataatattaaaacctatttcaagcggt
tctagtgtgggagtttctttaattaaaactaaagaagaatttgataatattgttaaagat
ataaaagatattcataattattttttagagccgtatattaaaggaaaagaagtaactgtt
ggtcttgtacgtgataatgatgatatatatgtatttcctatacttggcattaatccaaaa
aatgaaatatatgattatgatgctaaatatactccaggaaaaacggagatggagatacct
gcaaaattagataaagatatagaaaaaaaattaatagaaaattgtaaaaaggcttatgat
gttttaggctgtgagggtctttgcagaatagatgctataatttctgatgatggttttatt
aatttgatggaagttaatactcaaggcggcatgacaaacacttctgatatacctgccatg
gcaagaaatatcaatatgccttttgaagatgttgttttatatatactttctttatcttat
agaaatgtataa

DBGET integrated database retrieval system