KEGG   Brucella pinnipedialis B2/94: BPI_I1283Help
Entry
BPI_I1283         CDS       T01589                                 

Gene name
tuf-1
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bpp  Brucella pinnipedialis B2/94
Brite
Translation factors [BR:bpp03012]
 Eukaryotic Type
  Elongation factors
   BPI_I1283 (tuf-1)
 Prokaryotic Type
   BPI_I1283 (tuf-1)
Mitochondrial biogenesis [BR:bpp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BPI_I1283 (tuf-1)
Exosome [BR:bpp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BPI_I1283 (tuf-1)
  Exosomal proteins of breast cancer cells
   BPI_I1283 (tuf-1)
  Exosomal proteins of colorectal cancer cells
   BPI_I1283 (tuf-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEK54550
LinkDB All DBs
Position
1:complement(1228631..1229806)
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKFFGEFKAYDQIDAAPEERARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKCDQVDDAELLELVELEVRELLSKYEFPGDEIPIIKGSALAALEDSSKE
LGEDAIRNLMDAVDSYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIKATTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREDVERGQVLCKPGSVKPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPAGTEMVMPGDNVAMDVTL
IVPIAMEEKLRFAIREGGRTVGAGIVSSIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgaacgtacgaagccccacgttaacatcggcacgattggtcac
gttgaccatggcaagacgtcgctgacggcggcgatcacgaagtttttcggcgaattcaag
gcgtatgaccagatcgacgccgcgcctgaagaacgcgcccgcggcatcacgatctcgacg
gcccacgtcgagtacgagaccgcaaaccgtcactatgcgcacgtcgattgccccggccac
gccgactatgtgaagaacatgatcaccggcgctgcccagatggatggcgcgatcctggtg
gtttcggctgctgacggcccgatgccgcagacccgcgagcacatcctgcttgcccgtcag
gttggcgttccggcgattgtcgtgttcctcaacaagtgcgaccaggttgacgatgcagaa
ctgctcgaactggttgaactggaagtgcgcgaacttctgtcgaagtacgaattccccggc
gacgaaatcccgatcatcaagggctcggctcttgctgctctggaagattcttccaaggaa
ctgggcgaagatgccatccgcaacctgatggacgcggttgacagctacattccgaccccg
gaacgcccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgtggtacggttgtgacgggtcgcgttgagcgcggtatcgttaaggtcggtgaagaagtt
gaaatcgtcggcatcaaggcgacgacgaagaccacggttaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggctggcgacaacattggcgcgctgatccgcggcgttggc
cgtgaagacgttgaacgcggccaggttctctgcaagccgggttctgtgaagccgcacacc
aagtttaaggcagaagcctatattctgaccaaggacgaaggtggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgtacgacggacgtgacgggtgttgtgacg
cttccggctggcacggaaatggtcatgcctggcgataacgtcgccatggacgttaccctg
atcgtgccgatcgccatggaagagaagcttcgcttcgctatccgtgaaggcggccgcacc
gtcggtgccggcatcgtctcgtcgatcatcgagtaa

DBGET integrated database retrieval system