KEGG   Brucella pinnipedialis B2/94: BPI_I1321Help
Entry
BPI_I1321         CDS       T01589                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpp  Brucella pinnipedialis B2/94
Pathway
bpp00473  D-Alanine metabolism
bpp00550  Peptidoglycan biosynthesis
bpp01100  Metabolic pathways
bpp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BPI_I1321 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BPI_I1321 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BPI_I1321 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpp01011]
    BPI_I1321 (ddlA)
Enzymes [BR:bpp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BPI_I1321 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:bpp01011]
 Precursor biosynthesis
  Amino acid ligase
   BPI_I1321 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEK54585
LinkDB All DBs
Position
1:complement(1261870..1262916)
Genome map
AA seq 348 aa AA seqDB search
MRIVVLFGGRSAEHDVSVLSATNVMNALDPAKYEAVPVFVTRAGQWLLSRFVNGALEKPS
SGAELCLVPGGCGRAIVVPDAGAPYEADKIDIIFPVLHGLHGEDGAVQGLAQVARVPLAG
CGIPGSANALDKDIAKRLVNEAGLSTAKSVTITREEVPAFSALEQALGLPIFIKPARQGS
SVGVHKVVTEADYQAAMSDGFTYDDKLLAEEFIQAREVECGVLEDEGGALFVSRAGEIVP
AESHCFYSYDAKYIDADGTEIKVPAELPEQVENEIRAIAAKAFRVLGCDSMARVDFFVTA
DRRIVLNEINTIPGFTDMSMYSKVMAVSGVSYPEIINRLVAHGLARGS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgttgtcctctttggtggacgctcagcggagcatgatgtttccgttctttca
gcaaccaatgtcatgaatgcgctggatccggccaaatatgaggctgttcctgtttttgta
acacgcgcgggacaatggctgttgagccgcttcgtgaacggtgcgctggaaaagccgtca
agcggcgcagagctttgccttgttccgggcggctgtgggcgtgccatcgtggttcctgat
gccggcgctccatacgaggcggacaaaatagatatcatatttccggttctgcatggcctt
catggggaagatggtgctgtgcaaggcttggctcaggttgcgcgagtaccgctggcaggt
tgtggtattccaggttccgccaatgcactcgacaaggatattgccaagcgcctggtcaat
gaagcgggcctgtccacggcaaaatccgtgaccatcacgcgcgaagaggttcccgctttc
agtgcgctcgaacaggctttgggtttgcccatatttatcaaacccgcccgtcagggttcg
tctgtcggtgtccacaaggttgtaacggaagcagattatcaggctgccatgtccgatggt
ttcacttatgacgataagctgctggctgaagagttcattcaggcgcgcgaagttgaatgc
ggcgttcttgaagacgaaggaggcgcgctgttcgtctcgcgcgctggcgagattgtgcct
gcggaaagccactgtttttatagttatgatgccaaatatatcgatgccgatggaactgag
atcaaggttcctgcggagttgcccgaacaggtagagaatgaaatccgtgcgatcgccgcc
aaggctttccgggttctgggctgcgattccatggcgagggttgatttttttgttacggca
gacaggcgtatcgtgctgaatgaaatcaacactattcccggcttcaccgatatgagcatg
tattccaaggtgatggctgtgagcggtgtaagctatcctgaaattatcaatcgattggtt
gcgcatggcttggcgcggggaagctga

DBGET integrated database retrieval system