KEGG   Brucella pinnipedialis B2/94: BPI_I451Help
Entry
BPI_I451          CDS       T01589                                 

Gene name
fabI-1
Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bpp  Brucella pinnipedialis B2/94
Pathway
bpp00061  Fatty acid biosynthesis
bpp00780  Biotin metabolism
bpp01100  Metabolic pathways
bpp01130  Biosynthesis of antibiotics
bpp01212  Fatty acid metabolism
Module
bpp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bpp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BPI_I451 (fabI-1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BPI_I451 (fabI-1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BPI_I451 (fabI-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bpp01004]
    BPI_I451 (fabI-1)
Enzymes [BR:bpp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BPI_I451 (fabI-1)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BPI_I451 (fabI-1)
Lipid biosynthesis proteins [BR:bpp01004]
 Fatty acid synthase
  Component type
   BPI_I451 (fabI-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AEK53758
LinkDB All DBs
Position
1:445483..446301
Genome map
AA seq 272 aa AA seqDB search
MTAQSGLLQGKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQGDALKKRVEPLAEELG
AFVAGHCDVADAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTM
LISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDL
GPQNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIDEVGDVGLYFLSDLS
RSVTGEVHHADSGYHVIGMKAVDAPDISVVKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacagtctggtttgttgcagggcaagcgtggattgattctaggcgtggccaat
aatcgctctatcgcttggggcattgcaaaagccgcccgtgaagctggcgcagagcttgca
ttcacctatcagggtgacgcattgaagaagcgtgtggagccgctggccgaggagcttggc
gccttcgtcgccggacattgcgacgtcgccgatgcggcgagcatcgatgcggtttttgaa
acgcttgagaagaagtggggcaagctcgacttcctggtgcacgcaatcggtttctccgac
aaggacgagctgaccggccgctatatcgatacgtcggaagccaatttcaccaatacgatg
ctgatttcggtctattcgctgacggcggtttcgcgccgcgcggaaaagctgatggccgat
ggcggatcgattctgacgctgacctattacggcgctgaaaaggtcatgccgaattacaat
gtcatgggcgtggccaaggcagcccttgaggcgagcgtgaaatatctggccgtcgatctt
ggcccccagaacattcgcgtcaatgcaatctcggctggccccatcaagacgcttgccgct
tccggcattggtgacttccgctatatcctgaagtggaacgaatataatgcgccgctgcgc
cgcaccgtcacgatcgacgaggtgggtgatgtcggcctttatttcctttcggacctgtcg
cgttcggttacaggcgaagtgcaccatgccgacagcggctatcatgtcattggcatgaaa
gcggttgacgcaccggatatctcggtcgtgaaagactga

DBGET integrated database retrieval system