KEGG   Burkholderia pseudomallei BPC006: BPC006_I2229Help
Entry
BPC006_I2229      CDS       T02301                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD) family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00010  Glycolysis / Gluconeogenesis
bpq00053  Ascorbate and aldarate metabolism
bpq00071  Fatty acid degradation
bpq00280  Valine, leucine and isoleucine degradation
bpq00310  Lysine degradation
bpq00330  Arginine and proline metabolism
bpq00340  Histidine metabolism
bpq00380  Tryptophan metabolism
bpq00410  beta-Alanine metabolism
bpq00561  Glycerolipid metabolism
bpq00620  Pyruvate metabolism
bpq00625  Chloroalkane and chloroalkene degradation
bpq00903  Limonene and pinene degradation
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
bpq01120  Microbial metabolism in diverse environments
bpq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPC006_I2229
   00053 Ascorbate and aldarate metabolism
    BPC006_I2229
   00620 Pyruvate metabolism
    BPC006_I2229
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BPC006_I2229
   00561 Glycerolipid metabolism
    BPC006_I2229
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPC006_I2229
   00310 Lysine degradation
    BPC006_I2229
   00330 Arginine and proline metabolism
    BPC006_I2229
   00340 Histidine metabolism
    BPC006_I2229
   00380 Tryptophan metabolism
    BPC006_I2229
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPC006_I2229
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPC006_I2229
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BPC006_I2229
Enzymes [BR:bpq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BPC006_I2229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFR16099
LinkDB All DBs
Position
I:complement(2200130..2201566)
Genome map
AA seq 478 aa AA seqDB search
MKTCEQFYIGGAWRPSTGKGMIDVIDSGTEAVIGRVPEGTAEDAKAAVAAARAAFDGWAA
TPPAERARYLHKITENLKARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWGAYAKLAET
FAFEEQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEVAPLNAF
ILAEAIHDAGLPAGVFNLVCGYGPVVGEALASDADVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYEEARDLAK
AAAQAYVAGDPRDDATRLGALASSVQQKRVQDYIRRGIDEGAELVTGGLGMPEGITRGFF
VKPTVFGRVKPDATIAQEEIFGPVLSILTYRDEDDAVRIANDSPYGLGGAVWAGSDERAM
RVARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGVYGLDEYLEYKSMQLRPHKRA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctgcgaacagttctacatcggcggtgcatggcgcccgagcacgggcaagggc
atgatcgacgtgatcgactccggcaccgaggccgtgatcggccgcgtccccgaaggcacc
gccgaagacgcgaaagcggccgtcgcggccgcgcgcgcggcgttcgacggctgggccgcg
acgccgcccgccgagcgcgcccgctatctgcacaagatcaccgagaacctgaaggcgcgc
agcgaggagctcgcgcaatcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtcggcgggccgatctacaactggggcgcgtatgcgaaactcgccgagacc
ttcgcgttcgaggagcaggtgggcaattcgctcgtcgtgcgcgagcctgtcggcgtcgtc
gcggcgatcacgccctggaactatccgctcaaccagatcacgctgaaggtcgcggccgcg
ctcgcggcgggctgcacggtcgcgctgaagccgtccgaggtcgcaccgctcaatgcgttc
atcctcgccgaggcgattcacgacgcggggctgcccgccggcgtgttcaatctcgtgtgc
ggctacgggcccgtcgtcggcgaggcgctcgcgagcgacgccgatgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctcgccgcggccggcgtgaag
cgcgtcgcgctcgaactgggcggcaaatcggcgtcggtgattctcgacgacgccgatttc
gcggccgcggtgaagggcacggtgtccgcgtgctatctgaacgccgggcagacgtgttcc
gcgcatacgcgcatgctcgtgcccgaatcgcgctacgaggaggcgcgcgacctcgcgaag
gccgccgcgcaagcctatgtcgcgggcgatccgcgcgacgacgcgacgcggctcggcgcg
ctcgcgtcgtcggtccagcaaaagcgcgtgcaggattacatccggcgcggcatcgacgaa
ggcgcggagctcgtcacgggcggcctcggcatgccggagggcatcacgcgcggcttcttc
gtgaagccgaccgtgttcgggcgcgtgaagcccgacgcgacgatcgcgcaggaggagatc
ttcggcccggtgctgtcgattctcacgtatcgcgacgaggatgacgcggtgcgcatcgcg
aacgattcgccgtacgggctcggcggcgcggtgtgggcgggcagcgacgagcgcgcgatg
cgcgtcgcgcgccgcatccgcacggggcaggtcgatatcaacggcggggcatggaacatg
gccgcgccgttcggcggtttcaaacagtcgggcatcggccgcgagaacggcgtgtacggc
ctcgacgaatatctcgaatacaaatcgatgcaattgcgcccgcacaagcgcgcgtga

DBGET integrated database retrieval system