KEGG   Burkholderia pseudomallei BPC006: BPC006_I4044Help
Entry
BPC006_I4044      CDS       T02301                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00010  Glycolysis / Gluconeogenesis
bpq00620  Pyruvate metabolism
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
bpq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPC006_I4044
   00620 Pyruvate metabolism
    BPC006_I4044
Enzymes [BR:bpq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BPC006_I4044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFR17866
LinkDB All DBs
Position
I:3925027..3926646
Genome map
AA seq 539 aa AA seqDB search
MHRGAACWHGFGVTNGVAHVARRITDTDMRGATMNHADMQHLNIEFPYRKQYGNFIGGEW
VAPVGGEYFDNVSPVTGRPFTAIPRSREADIELALDAAHAAKAGWAAKGAAERANVLLRI
ADRMEANLTRLAVAETIDNGKPLRETTAADVPLAIDHFRYFAGCIRAQEGSIADIGGDMV
AYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALAAGNCVVLKPAEQTPASILVFAELIQDL
LPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTGETSTGRLIMQYASENLIPVTLELGGKS
PNIFFADVMDRDDSYFDKALEGFAMFALNQGEVCTCPSRALVEESIYDRFIERALKRVEA
IKQGHPLDSQTMIGAQASAEQLEKILSYIDIGRGEGAQCLTGGERNVLGGELAEGYYVKP
TVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEALEIANDTLYGLGAGVWTRDGNRAYRFGR
GIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcggcgcggcgtgctggcacggttttggcgtaacgaacggcgtcgcgcacgtc
gcgcggcgcatcaccgataccgacatgcgaggagcaacgatgaatcacgcggacatgcaa
catctgaacatcgaattcccgtaccgcaagcagtacgggaatttcatcggcggcgaatgg
gtcgccccggtcggcggcgagtatttcgacaacgtctcgcccgtcaccggccggccgttc
accgcgatccctcgctcgcgcgaagccgacatcgagctcgcgctcgacgccgctcacgcg
gccaaggcgggctgggccgcgaagggcgcggccgagcgcgcgaacgtgctgctgaggatc
gccgaccggatggaggcgaacctcacgcgcctcgccgtcgccgagacgatcgacaacggc
aagccgctgcgcgaaaccaccgcggccgacgtgccgctcgcgatcgaccacttccgctac
ttcgcgggctgcatccgcgcgcaggaaggctcgatcgccgatatcggcggcgacatggtg
gcctaccacttccacgagccgctcggcgtcgtcggccagatcatcccgtggaacttcccg
ctgctgatggccgcgtggaagctcgcgccggcgctcgcggccggcaactgcgtcgtgctc
aagccggccgagcagacgcccgcgtcgatcctcgtgttcgccgagctgatccaggatctg
ctgccgcccggcgtgctcaacatcgtcaacggcttcggcctcgaggccggcaagccgctc
gcgtcgagcaagcggatcgcgaagatcgcgttcacgggcgagacgtcgacgggccgcctc
atcatgcagtacgcgagcgagaacctgattcccgtcacgctcgagctgggcggcaagagc
ccgaatattttcttcgccgacgtgatggatcgcgacgacagctacttcgacaaggcgctc
gaaggcttcgcgatgttcgcgctgaaccagggcgaagtctgcacgtgcccatcgcgcgcg
ctcgtcgaggagagcatctacgatcgcttcatcgaacgcgcgctcaagcgcgtcgaggcg
atcaagcagggccatccgctcgattcgcagacgatgatcggcgcgcaggcgtcggccgag
cagctcgagaagatcctgtcgtacatcgacatcggccgcggcgaaggcgcgcaatgcctg
acgggcggcgagcgcaacgtgctcggcggcgagctcgccgaaggctattacgtgaagccg
accgtgttccgcggccacaacaagatgcgcatcttccaggaagaaatcttcgggccggtg
ctcgcggtgacgacgttcaagaccgaggaggaagcgctcgagatcgcgaacgacacgctg
tacggcctgggcgccggcgtctggacgcgcgacggcaaccgcgcgtaccgcttcggccgc
ggcatccaggcgggccgcgtgtggacgaactgctatcacgcgtatccggcgcacgcggcg
ttcggcggctacaagcaatccggcatcggccgcgagacgcacaagatgatgctcgaccac
taccagcagacgaagaacctgctcgtcagctacagcgaaaagccgctcgggttcttctga

DBGET integrated database retrieval system