KEGG   Burkholderia pseudomallei BPC006: BPC006_II1646Help
Entry
BPC006_II1646     CDS       T02301                                 

Definition
(GenBank) putative D-xylulose reductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00040  Pentose and glucuronate interconversions
bpq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BPC006_II1646
Enzymes [BR:bpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BPC006_II1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AFR19573
LinkDB All DBs
Position
II:1676210..1677244
Genome map
AA seq 344 aa AA seqDB search
MKALVLEKARELALRDIDLPLEVGPADVKIRVHTVGVCGSDVHYYMHGGIGPFRVDAPMV
LGHEASGTVVEVGRDVTYLRVGERVCMEPGVPRFDSKATLHGLYNLDPSVRFWATPPVHG
CLAPYVVHPAAFTYRLPPNVSFAEGAIVEPLAIGLQAAKKAAMKPGDIAVVVGAGTIGAM
TALAALAGGAARVILADVVKEKLALFAANRAVTTVDASTQSLADAVAHATDGWGADVVFE
ASGNASAYAGIVDLLCPNGCLVLVGMPLAPVPLDVVSLQAKEARIESVFRYANVFPRALA
LIASGAIDVKPFISRTFPFSDGLRAFEAAASGQPHDVKIQIEMD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccctcgtactcgaaaaggcgcgcgagctcgcgctgcgcgacatcgatctgccg
ctcgaggtcggccccgccgacgtcaagatccgcgtccacacggtgggcgtgtgcggcagc
gatgtccattactacatgcacggcggaatcggcccgttccgggtggacgcgccgatggtg
ctcggccacgaggcgtcgggcacggtcgtcgaggtcgggcgcgacgtcacgtacctgcgc
gtgggcgagcgcgtgtgcatggagcccggcgtgccgcgcttcgattcgaaagcgacgctg
cacggcctgtacaacctcgatccgtcggtgcgcttctgggcgacgccgcccgtgcacggg
tgcctcgcgccctacgtcgtgcacccggcggcgttcacgtaccggctgccgccgaacgtg
tcgttcgccgagggcgcgatcgtcgagccgctcgcgatcgggctgcaggccgcgaagaag
gcggcgatgaagccgggcgacatcgcggtggtcgtcggcgcgggcacgatcggcgcgatg
acggcgctcgccgcgctcgcgggcggcgccgcgcgcgtgatcctcgccgacgtcgtcaag
gaaaagctcgcgctgttcgccgcgaaccgcgcggtgacgacggtcgacgcgagcacgcag
tcgctcgccgatgcggtcgcgcacgcgaccgacggctggggcgcggacgtggtgttcgag
gcaagcggcaacgcgagcgcgtatgcgggcatcgtcgatctgctgtgcccgaacggctgc
ctcgtgctggtcggcatgccgctcgcgccggtgccgctcgatgtcgtttcgctgcaggcg
aaggaggcgcgcatcgaatcggtgttccgctacgcgaacgtcttcccgcgcgcgctcgcg
ctgatcgcctccggcgcgatcgacgtgaagccgttcatctcgcgcacgttcccgttctcg
gacggcctgcgcgcattcgaggcggcggcgagcggccagccgcacgacgtgaagattcag
atcgaaatggattga

DBGET integrated database retrieval system