KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0181Help
Entry
GBP346_A0181      CDS       T00894                                 

Definition
(GenBank) flagellar basal body P-ring biosynthesis protein FlgA
  KO
K02386  flagella basal body P-ring formation protein FlgA
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    GBP346_A0181
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bpr02035]
    GBP346_A0181
Bacterial motility proteins [BR:bpr02035]
 Flagellar system
  Flagellar assembly proteins
   M,S,P and L rings
    GBP346_A0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ChapFlgA ChapFlgA_N SAF
Motif
Other DBs
NCBI-ProteinID: ACQ96109
UniProt: C4KMX5
LinkDB All DBs
Position
I:complement(159414..160943)
Genome map
AA seq 509 aa AA seqDB search
MTTDAGRATRTRFAVALALAGWMGAALAQQAGDGGMIVIPGRGESAQTALANANAASARG
ANGAGAAGPGGADRTASPGGWHAPAAAQAAAAWSGRAGAASGAESAAESGDVRAATEPRT
GLIVIEPGPAESNGRIPAAAPSGWHPSAAMPRAESNGGANPVPPRTGSNRSAGPASASAG
WTAPPGAASQGNPAANVAPAPRVSAASRAPATTDMQRVAPVIAQDEGAAPAGRPANARAA
AQSWPARDPSVAAGGVIPVSLRAQPAPRTLPVRSAPIRAAATSAAGAQPAAASATAAGAV
PAGQQDGESIRRAALAFLQQQAAGLPGKTTVTVAPAFPRGLAACTTLEPFLPSGARLWGR
TTVGVRCAGERPWTIYLQAKLAVQATYYVAARQIAPGETLTAADLVARDGDLTLLPLAVI
TDAQQAVGATALTRVAAGLPLRQDLLKSAASVSIGQTVRVVASGQGFTISAEGSVLNNAA
PGQQVRVRMAAGQIVTAIVKDAATVEIPL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgacgcaggccgcgcaacgcgcacgcgctttgccgtggcgctcgcgctggcg
ggctggatgggcgcggcgctcgcgcagcaggcgggcgacggcgggatgatcgtgattcca
ggccgcggcgaatcggcccagaccgcgctcgcgaatgcgaatgcggcgagcgcgcgcggc
gcgaacggcgcgggcgcggcgggcccgggcggcgccgaccgtacggcaagcccgggcgga
tggcacgcgccagccgccgcgcaggcggccgccgcgtggagcggccgcgccggcgcggcc
tcgggcgcggaatcggcagcggaatcgggcgatgtccgtgcggcgaccgagccgcgcacc
ggcctgatcgtgatcgaacccggtccggccgaatcgaatggccgaatcccggccgccgcc
ccgagcgggtggcacccctccgcggccatgccgcgagccgaatcgaacggcggcgcgaat
cccgtgccgccgaggaccggatcgaatcgttccgccggccccgcgtcggcaagcgccgga
tggaccgcgccgcccggcgcggccagccaaggcaaccctgcggcgaacgtcgcccccgcg
ccccgcgtgagcgccgcctcgcgcgcaccggccacgaccgatatgcagcgagtcgcgccc
gtcatcgcccaggacgaaggggccgcaccggccggccggcccgcgaacgcgcgggcggcg
gcgcaatcatggcccgcgcgggacccgagcgtcgcggcgggcggcgtgatccccgtgtcg
ctgcgcgcgcagcccgcaccgcgcacgctgcccgtgcgctccgcgccgattcgggcggcg
gcgacgagcgcggccggcgcgcagccggcggccgcctccgccacggcggccggcgcggtt
cccgccggccaacaggacggcgaatcgatccgccgcgcggcgctcgcgttcctgcagcag
caggcggccggcctgcccggcaagaccaccgtcacggtcgcgccggccttcccgcgcggg
ctcgccgcatgcacgacgctcgagccgttcctgccttcgggcgcgcgcctgtggggccgt
acgaccgtcggcgtgcgctgcgcgggcgagcgcccgtggacgatttaccttcaggcgaag
ctcgccgtgcaggcgacctattacgtcgccgcgcgccagatcgcgcccggcgagacgctc
acggccgccgatctcgtcgcgcgcgacggcgacctgaccctgctgccgctcgcggtgatc
accgatgcgcagcaggcagtcggcgccaccgcgctcacgcgggtcgcggcggggctgccg
ctgcgtcaggatctgttgaagagcgcggcgtcggtatcgatcggacagacagtgcgggtg
gtcgcgtcgggccaggggttcacgatttcggcggagggcagcgtgctcaacaacgcggcg
cccggccagcaggtgcgggtgcggatggcggcgggccagatcgtcacggcgatcgtcaag
gacgccgcgacggtggaaatccccctctaa

DBGET integrated database retrieval system