KEGG   Burkholderia pseudomallei MSHR346: GBP346_A3933Help
Entry
GBP346_A3933      CDS       T00894                                 

Gene name
tuf_1
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bpr  Burkholderia pseudomallei MSHR346
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bpr03012]
    GBP346_A3933 (tuf_1)
   03029 Mitochondrial biogenesis [BR:bpr03029]
    GBP346_A3933 (tuf_1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpr04147]
    GBP346_A3933 (tuf_1)
Translation factors [BR:bpr03012]
 Eukaryotic Type
  Elongation factors
   GBP346_A3933 (tuf_1)
 Prokaryotic Type
   GBP346_A3933 (tuf_1)
Mitochondrial biogenesis [BR:bpr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GBP346_A3933 (tuf_1)
Exosome [BR:bpr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GBP346_A3933 (tuf_1)
  Exosomal proteins of breast cancer cells
   GBP346_A3933 (tuf_1)
  Exosomal proteins of colorectal cancer cells
   GBP346_A3933 (tuf_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACQ97805
UniProt: C4KWX6
LinkDB All DBs
Position
I:complement(3772225..3773415)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIKATAKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagaagtttgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcgcgacggtgctgtcggcgaagttc
ggcggcgaagcgaagaagtacgacgaaatcgacgcggcgccggaagaaaaggcgcgcggc
atcacgatcaacaccgcgcacatcgagtacgaaacggcgaaccgccactacgcacacgtg
gactgcccgggccacgccgactacgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgatcctggtgtgctcggccgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggtgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgcggagctgctcgagctggtcgaaatggaagtgcgcgaactgctgtcgaag
tacgacttcccgggcgacgacacgccgatcatcaagggttcggcgaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggcgatcatgaacctggccgacgcgctggacacg
tacatcccgacgccggagcgtgcggtcgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgtggtacggtggtgacgggtcgtgtcgagcgcggcgtgatcaag
gttggcgaggaaatcgaaatcgtcggtatcaaggcgacggcgaagacgacctgcacgggc
gtggaaatgttccgcaagctgctggatcagggtcaggcgggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgcggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgccacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgcgccgatcgcgatggaagaaggtctgcgcttcgcgatccgc
gaaggcggtcgcaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system