KEGG   Beta proteobacterium CB: D521_0218Help
Entry
D521_0218         CDS       T02483                                 

Definition
(GenBank) Ribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
bprc  Beta proteobacterium CB
Brite
KEGG Orthology (KO) [BR:bprc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bprc03016]
    D521_0218
Enzymes [BR:bprc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     D521_0218
Transfer RNA biogenesis [BR:bprc03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    D521_0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: AGG32788
UniProt: M1SL62
LinkDB All DBs
Position
204159..206147
Genome map
AA seq 662 aa AA seqDB search
MHLLYEEGGDIKVATVQSASGAGDAESWQATSLSGKKIKLKAKEVWLRFEKPEPQALMDE
ASALSKEIDLQFLWDCAPDEEFGLVDVAQEYFGAQASIPQQTALAIALQGAPVFFRRKGR
GRFQRAPLEQLQAGLAALERKQKELEQQAAWQKELVAGVFPETLKSQANQLLFSPDKNTS
AYKALIAACTESGESPAQLMIRCGAIDSPLQYHQGMFLKAHFPRGAAHDPSSVVEQVALD
AAIAELPLAEVSAFSIDDSGTTEIDDALSVTALEEGGHRIGIHIAAPGLVIAKDDALDRV
ARTRMSTVYFPGDKITMLPDSVIQQFSLDEGAPRPALSIYVDIDSAGVVDRDSLQLRAEM
VPMGANLRLENLEHLVTEESLADESADYAYRQELSILWGAAKLLHAGRQEQRVANGLRAE
QLGLLDPNALARDFHFQIQEVNGAQRVAITPRQRGSILDTIVAEWMIYCNSASGRLLADH
GIPGLFRTQKGWGPLRTRMQTTPGPHEGLGLEYYAWCTSPLRRYSDLVNQWQLIAIAKHG
ITAKMVAPFPPRDAALMGIAADFEACYSAYGEYQDRLEKYWCLRWVAQDEVPKQVFVRHL
KEGMSRVEPIPLHLPVPELATHPRMTRAEVSIADVDLLQLTAGVRLLYIETPEVPESDAS
PT
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttttatatgaagagggtggcgacatcaaggtcgccacagtccagtccgcctcc
ggcgcaggagatgctgagtcatggcaagcaaccagcctttctggcaaaaaaattaagtta
aaggcgaaagaagtttggcttcgttttgaaaagccagagccacaagctttaatggatgaa
gctagtgctctatctaaagagattgatctgcaatttttatgggactgtgcaccagatgaa
gaatttggtttggtggatgttgctcaagaatactttggtgcgcaagccagcattccacag
cagactgcattagccattgctctgcagggcgcgccagtattttttcgtcgcaaagggcgg
gggcgttttcaaagggcgccgctggagcaattacaggctggtttagcagcgcttgagcgt
aagcaaaaagagctggagcagcaagccgcttggcaaaaagagctcgtagctggcgtattt
ccagaaacgctgaagtctcaggcaaaccaactcctgttttctccggataaaaatacctct
gcttacaaagcattaattgcggcatgtaccgagtcaggtgaatctccggcacagttgatg
atccgttgtggcgcaattgattcacctttgcaatatcaccagggcatgttcttgaaagcc
cacttccctcggggtgctgcacatgatccaagttcagttgtagagcaggtcgcattagat
gctgctattgcagagttgcccttagctgaagtaagcgccttctcgatagatgattcaggc
actactgaaattgatgatgctttatcggtcactgcgcttgaagagggtgggcaccgtatt
ggtattcacattgccgcgcctggcctagtgatcgccaaggatgacgctttagatagggtc
gcacgcactcgcatgtctaccgtgtatttccctggtgacaagatcacaatgttgccggac
tctgtcattcagcagttctcactggatgagggcgctcctcgcccagctttatcgatttat
gtagacatcgattcggctggagtggtggacagagattcattgcagttgcgcgctgagatg
gttccgatgggagcaaatctgcgcttagagaatttggagcatctggtaacagaagaaagt
ttggctgatgaatcagctgactatgcgtatcgtcaggagctcagcattttgtggggcgcg
gcaaagttattgcatgcaggtcgccaggagcaacgagtagccaatggattacgcgccgag
caactagggctcttagatcccaatgctttggcgagagactttcattttcaaatccaagaa
gttaatggtgcgcagcgagtagcaatcactccgcgccagcgcggttcaatcctagatacg
atcgttgcggagtggatgatttattgcaatagcgcatcaggacgtttgctggctgaccat
gggatacccggcttgttccgaactcaaaagggctggggccctttgcgtactcgtatgcag
acaacccctggtcctcatgagggattgggtttggagtattacgcatggtgtacatcgccc
ttgcgccgctattcagacttggtgaatcagtggcagttgattgcgatagccaagcatggc
attactgccaagatggtggcgccattcccgccgcgagatgctgctttgatgggtatcgct
gctgacttcgaagcttgctattcagcctatggtgaataccaggatcgccttgagaaatat
tggtgcttgcgctgggttgctcaggatgaggtgcctaagcaagtttttgtgagacatctc
aaagaaggcatgtcccgagtagagcccatcccattgcatttaccggtcccagagttggct
acgcatcctcgtatgactcgagctgaagtcagtattgctgacgtagatcttttgcaactg
actgcaggagtgcgacttctttatatagaaactccagaagtccctgagagtgatgcaagt
cccacctaa

DBGET integrated database retrieval system