KEGG   Beta proteobacterium CB: D521_0398Help
Entry
D521_0398         CDS       T02483                                 

Definition
(GenBank) hypothetical protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bprc  Beta proteobacterium CB
Brite
KEGG Orthology (KO) [BR:bprc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D521_0398
Enzymes [BR:bprc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D521_0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_binding_3 DAO Thi4 FAD_oxidored FMO-like NAD_binding_8 AlaDh_PNT_C K_oxygenase NAD_binding_9 Thioredoxin_4 Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: AGG32968
UniProt: M1SLP0
LinkDB All DBs
Position
complement(362062..363606)
Genome map
AA seq 514 aa AA seqDB search
MLDTNIKAQLKTYFEKIESPIVLEATLDDSTQSAQMLELLNEVAEQSAKITVKTSGSSKN
IPSFTVAKVDEVARIAFSGLPMGHEMTSFILAILQSSGYPPKVEQDVIESIKGLEGKKRF
QTFISLSCHNCPDVVQALNLMAALNPEIEHEMIDGALFQGLVDQYQIMAVPTVILNGEVF
GQGRMSVEEIAAKLDTNSSARDAEKLNTKAAYDSLIIGGGPAGASAAIYSARKGIRTGVV
AQKFGGQVADTVGIENFISVKETEGPKLVMALEQHVKEYDVDLMNLQTAKSLSKTGDEIA
ITLENGAVLKSKTVILSTGARWREMNVPGEQEYRGKGVAYCPHCDGPLYKGKRVAVIGGG
NSGVEAAIDLAGIVSHVTLVEFDTKLRADAVLQKKLNSLPNVTIITNALSKEVLGANGKV
TTLRYEDRANNQMHDIALEGIFVQIGLLPNTDWLKGVIDLSPRGEVIIDQKGETSMPGVF
AAGDCTTVPYKQIIIAMGEGAKASLSAFDYLIRS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttagataccaacattaaggcccaactcaagacctattttgaaaaaattgagagcccc
attgttttggaggctactttagatgacagcactcagtcagctcagatgttggagctttta
aatgaggttgctgaacaatctgccaagatcacagtgaagacttctggcagtagcaaaaat
attcctagcttcaccgtagccaaggtggatgaagttgcccgcattgcattctcaggcctg
ccaatgggtcatgagatgacttctttcatcttagcaatcttgcagagcagtggttaccca
ccaaaagtagagcaagatgtgatcgaaagtattaagggcttagagggtaagaagcgtttt
cagacattcatctctttgtcttgccacaactgcccagatgtcgttcaggccttgaatctc
atggctgcactgaatcctgaaatcgaacatgaaatgattgatggcgcactcttccagggc
ttggtagatcaatatcagatcatggctgtacctacagtgattctgaatggtgaagtcttt
ggccaaggccgtatgagtgttgaagagattgctgccaaactcgataccaattcttcagca
cgcgatgcagaaaaattgaatactaaagctgcttacgattccttaattattggcggcggt
ccagcaggcgcttcagcagcaatctactctgctcgtaaaggtatcagaaccggtgtggta
gcccagaaatttggcggtcaggttgccgataccgttggcattgaaaacttcatctccgtt
aaagaaactgaaggtcctaaattagtaatggctcttgagcaacacgttaaggaatacgac
gttgatctaatgaacctgcaaaccgcaaagagcttaagcaagacaggtgatgaaattgca
atcactctagaaaatggtgccgtcctaaaaagtaagaccgtcattttgagcactggtgca
cgctggcgcgaaatgaatgttccgggtgagcaagagtaccgtggtaaaggcgtggcttac
tgccctcactgtgacggccccttatacaaaggtaagcgcgtagcggtgattggcggagga
aactctggagttgaggctgcaattgatctagctggaattgtgagccatgttactttggtt
gaattcgataccaagctgcgtgccgatgcagtgctgcagaagaaattaaacagcctgcct
aacgtaaccatcattaccaatgccttgagtaaagaagttttaggtgcaaatggcaaagta
actaccttgagatatgaagatcgtgccaataaccagatgcatgacatagcgcttgaaggc
atcttcgttcaaattggattgttgcctaatactgattggctcaagggcgtgattgactta
tccccccgcggagaggtgatcattgatcagaagggtgagacatccatgccaggtgtattc
gctgctggtgactgcactaccgtaccttataagcaaatcatcattgccatgggtgaaggc
gctaaagcatcactctctgcctttgattatttaatcagatcataa

DBGET integrated database retrieval system