KEGG   Beta proteobacterium CB: D521_0599Help
Entry
D521_0599         CDS       T02483                                 

Definition
(GenBank) Short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bprc  Beta proteobacterium CB
Pathway
bprc00061  Fatty acid biosynthesis
bprc00780  Biotin metabolism
bprc01100  Metabolic pathways
bprc01130  Biosynthesis of antibiotics
bprc01212  Fatty acid metabolism
Module
bprc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bprc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D521_0599
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    D521_0599
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    D521_0599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bprc01004]
    D521_0599
Enzymes [BR:bprc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     D521_0599
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     D521_0599
Lipid biosynthesis proteins [BR:bprc01004]
 Fatty acid synthase
  Component type
   D521_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AGG33168
UniProt: M1SMA0
LinkDB All DBs
Position
complement(567898..568683)
Genome map
AA seq 261 aa AA seqDB search
MGFLAGKKILITGLLSNRSIAYGIAKACHREGAELAFTYVGERFKDRIVDFAKEFNTELI
FDCDVGSDEQISNLFKDLAKTWPQFDGFVHAIGFAPREAIAGDFLEGLSREGFKIAHDIS
AYSFPAMAKEALPMLRDKSSLLTLTYLGSLRNVPNYNTMGLAKASLEASVRYIAGSVGPK
GIRANGISAGPIKTLAAAGIKGFGKILDAVEQTAPMRRNVTIDDVGNTAAFLLSDLANGI
TAEIIYVDNGFSQVVGGMEEV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctcgctggcaaaaaaattctaattaccggccttctttctaaccgctctatt
gcctatggcattgccaaggcatgtcaccgcgaaggggctgaactggcctttacctacgtt
ggtgagcgctttaaagaccgtattgtcgatttcgcaaaagaattcaatactgagctgatt
tttgactgcgacgttggtagtgacgagcagatttcgaacctgttcaaagatttagcaaaa
acttggcctcagtttgatggctttgttcatgcaattggctttgcaccgcgcgaagccatc
gctggtgactttttagagggcttatcacgtgaaggcttcaaaattgcccacgatatttct
gcctacagcttcccagcaatggccaaagaagccttaccaatgctgcgtgacaaatcatct
ttgttgactctgacctacctcggtagcctgcgtaacgttccgaactacaacactatgggt
cttgctaaggcctccctggaagcctcggtacgctatatcgccggctcagttgggcctaaa
ggcattcgtgctaacggcatttctgctggcccaattaaaactttggctgctgctggcatc
aaagggtttggcaagattttggacgcagttgaacaaactgctccaatgcgtcgcaatgtc
acgattgatgatgtgggtaacaccgcagctttcttattgtctgatttagcaaacggtatt
accgctgaaattatttatgttgataacggatttagccaagttgttggcggaatggaagaa
gtttga

DBGET integrated database retrieval system