KEGG   Beta proteobacterium CB: D521_0625Help
Entry
D521_0625         CDS       T02483                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
bprc  Beta proteobacterium CB
Brite
KEGG Orthology (KO) [BR:bprc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    D521_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AGG33194
UniProt: M1SFL4
LinkDB All DBs
Position
complement(594899..595672)
Genome map
AA seq 257 aa AA seqDB search
MLELSVFDLSLLLACALFAGLVDSIIGGGGMIQVPALFAVLPGFPPATLLSVNKFGSIVG
TIGSAIQYSRANKSPWGLVIISSLFAFFASVAGAYLVTQLPTQWLRSALPFLLIALLIFN
IKSNAGLVHAPKHQHHKQKAIASTGAGIIGFYDGFLGPGAGAFYKLFYTRILGFDFLRSA
APAKFLNIASNLGALCVFFYLGYFDWQLGILMASANLIGGQIGTSIAIKHGNVFIRKGFF
ILVTILIIKTFYDAFLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaactctccgttttcgacctcagcttattgctcgcctgcgctttatttgcaggc
ctagttgattcaattattggtggtggtggcatgattcaggttccagctttatttgcagtg
ttacccggctttccacccgccacactactctccgttaataaatttggctcgattgtgggg
accattggctctgctattcagtacagtagagcaaacaaaagtccttgggggctggtaatt
atctcctctttatttgctttctttgcgtcggttgcaggggcctatctcgttacccagtta
cccactcaatggcttcgcagcgccctgccatttttactgatcgcactactgatatttaat
atcaaatcgaatgctggactggtgcatgcgccaaaacatcaacaccacaagcaaaaggcc
atcgcctctaccggagctggaattattggcttttatgatggctttttagggcctggagct
ggcgctttctataagctcttctatacgcgcattttgggttttgacttcctgagaagcgct
gcacccgccaagtttcttaatatcgcctcaaacctaggagctttatgtgtcttcttctat
ttgggctactttgactggcaattgggtatcctcatggctagcgccaacctgataggcggt
caaattgggactagtattgcgattaagcacggcaatgtctttattcgtaaaggctttttt
atcctagtaacgattctgattatcaaaactttctacgatgcttttttgaagtaa

DBGET integrated database retrieval system