KEGG   Beta proteobacterium CB: D521_0913Help
Entry
D521_0913         CDS       T02483                                 

Definition
(GenBank) hypothetical protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bprc  Beta proteobacterium CB
Pathway
bprc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bprc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    D521_0913
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bprc03400]
    D521_0913
Enzymes [BR:bprc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     D521_0913
DNA repair and recombination proteins [BR:bprc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     D521_0913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi IF2_N
Motif
Other DBs
NCBI-ProteinID: AGG33482
UniProt: M1T392
LinkDB All DBs
Position
899582..900142
Genome map
AA seq 186 aa AA seqDB search
MNMSTNSAFLKEMGITEWTSRDAVPEQVAEMIASEVPKDHSDARAPATSVAAENHEKISG
GKWWFYGNKPQGDAEVLFQNVIRVLGLTPQEWSWKNPAEQFNHEQLPQDGTPIVALAFGG
AVAQRLSGERDALPELRETVLAINADGAEDLPLIATFELNQLIARPKDKALFWQDLLLAK
SVLQNI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgagtacaaattccgcttttcttaaagagatgggtattactgagtggacttca
cgagatgccgtcccagaacaagtcgcagagatgattgcttctgaggtccctaaggatcac
tctgatgcgagggctcccgcaacttctgttgccgctgaaaaccacgagaagatttctggc
ggaaaatggtggttttatggcaataaaccccaaggtgatgctgaagtgctatttcagaac
gttatacgggtgcttggtttgactccacaagagtggtcctggaaaaatcctgctgaacaa
ttcaaccacgagcaattgccccaggacggaacgccaatagttgctcttgcatttggtgga
gctgttgcgcaaagattatcaggtgagcgagatgcactgccagagttgcgggaaactgtt
ttggcaatcaatgcagatggcgcagaggatctgccgctaattgctacttttgaattaaat
cagttgatcgctaggccaaaggataaggctctattttggcaggatttactgctggctaaa
tcagtattgcagaatatctaa

DBGET integrated database retrieval system