KEGG   Anaerostipes hadrus: CL2_03720Help
Entry
CL2_03720         CDS       T02612                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bprl  Anaerostipes hadrus
Pathway
bprl00473  D-Alanine metabolism
bprl01100  Metabolic pathways
bprl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bprl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CL2_03720
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CL2_03720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bprl01011]
    CL2_03720
Enzymes [BR:bprl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CL2_03720
Peptidoglycan biosynthesis and degradation proteins [BR:bprl01011]
 Precursor biosynthesis
  Racemase
   CL2_03720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CBL37453
UniProt: D4MXV8
LinkDB All DBs
Position
complement(341626..342789)
Genome map
AA seq 387 aa AA seqDB search
MNQYYRVHAVIDLDAICHNIREVKRVVGEGVKVMPVIKADGYGHGAVPIAKELNKIGVDA
FAVAILEEGITLRNNGIRQPILILGYTSEYQYSSLIQYEIEPTVFCYEMAESLSKIAQAL
GKDAKIHIKLDTGMNRIGFKPTKESVDIIEKIAKLPNIKIQGIFTHFACADEADKTETYE
QERKYDQFITWLEERDIYIPIKHVSNSASIIDLDGFRKDMVRSGIITYGLYPSEEVSKDV
LDLRPAMELKTHIVYIKEVEAGEGISYNHTYVTDKKTKIATIPVGYADGYPRSLSSKGKV
LIRGQYAPIIGRICMDQFMVDVTDVEGVSVMDEVTLVGHDGNKMLTVEEVANEAGSFNYE
FVCGIGKRVPRVYIRNGEMKETEYFEK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtactatagagtgcatgcagttattgatctggatgcaatctgtcataatata
agagaagtaaaacgtgtagttggagaaggtgtgaaagtaatgccagtgatcaaagctgac
ggatacggacacggagcagttccaattgcaaaagaattaaataagatcggagttgatgca
tttgccgttgcaatcctagaagaagggatcacacttcgaaacaatggaatcagacagcca
atcttgattttaggatacacatcagaatatcagtacagctcattgattcagtatgagatc
gagccaaccgtattctgctatgagatggcagagtccttatcaaagatcgcgcaggcacta
ggcaaagatgcgaagattcatatcaaactggatacaggaatgaaccgtatcggatttaaa
ccaaccaaagaatctgtagatatcatagagaagatcgccaaattaccaaatatcaagatt
caaggaatctttacacatttcgcatgtgcagacgaggcggataaaacagaaacttatgag
caggaacgaaaatatgatcagtttattacgtggcttgaggaaagagatatctatattccg
atcaaacacgtatcaaacagtgcatcgatcattgatctggatggatttagaaaagatatg
gtacgttcaggaatcattacttatggattatatccatcagaagaagtttcaaaagatgta
ttggatttaagaccagcaatggaattaaagacacacattgtatatatcaaagaagtggaa
gcaggagaaggaatcagttacaatcacacatatgtaactgataagaagacaaagatcgca
actatcccagtaggatatgcagacggatacccaagatcactctcttccaaaggaaaagta
ttgatccgtgggcaatatgcaccgatcattggaagaatctgtatggatcagtttatggtt
gacgtgacagatgttgaaggtgtatctgtgatggatgaagtaactttagtcggacacgat
ggcaataaaatgttgaccgtagaagaagttgcaaatgaagcaggatcttttaattatgaa
tttgtctgtgggattgggaaacgtgttccacgagtatacattcgaaacggagagatgaaa
gaaacagaatattttgaaaaataa

DBGET integrated database retrieval system