KEGG   Anaerostipes hadrus: CL2_05560Help
Entry
CL2_05560         CDS       T02612                                 

Definition
(GenBank) ABC-type multidrug transport system, ATPase component
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bprl  Anaerostipes hadrus
Brite
KEGG Orthology (KO) [BR:bprl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bprl02000]
    CL2_05560
Transporters [BR:bprl02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    CL2_05560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 SMC_N AAA_29 AAA_23 AAA_18 Mg_chelatase AAA_22 AAA_24 AAA_16 RsgA_GTPase AAA_30 TsaE MeaB AAA_5 G-alpha KAP_NTPase WbqC AAA
Motif
Other DBs
NCBI-ProteinID: CBL37620
UniProt: D4MYC5
LinkDB All DBs
Position
534221..534955
Genome map
AA seq 244 aa AA seqDB search
MKDLNLIELTDLEKRYGKKEALTGINLTIGRGKIIGLLGPNGSGKTTLIKLLNGLLQPTS
GEIKVNGKAPGVDSKKIISYLPDKMYFADWMKIADLMDFFEDFYEDFDRKKAEGMCETLK
INTEAKIKSLSKGNKEKVQLVLVMCRKAQLYLLDEPIAGVDPAARDFILDTILNNYNEEG
TVIISTHLIADIEKIMDEVIFIKEGNIVTYKSADDLREESGKSIDALFREIFHTDVYRGG
DEAC
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatttgaatttaatagaattaactgatttagagaaacggtatggaaagaaggaa
gctttaacgggaatcaacttaacaatagggagaggaaagatcatcgggcttttaggaccc
aatggttctggaaagacaacattgatcaagttattaaacggtctgttgcagccaacatca
ggtgagattaaagtcaatggtaaagcacctggtgttgacagcaagaagatcatcagctat
ctgccagataagatgtattttgcagattggatgaagattgcagatttgatggattttttt
gaagatttttacgaagactttgaccgtaaaaaagcagagggcatgtgtgagacattaaag
atcaacaccgaagcgaagatcaaaagcttatccaaaggaaataaagagaaagtccagtta
gttttggtaatgtgccgaaaagcacaactctatctgctagacgaaccgatcgcaggagtc
gatcccgcagcaagggattttatcttagatacgatcttaaacaattataatgaggaagga
accgtgatcatttcaacacatctgatcgcagatatcgagaagatcatggatgaggttatt
tttatcaaagaaggaaatattgtaacatacaagtcagctgatgacttaagagaagaaagt
ggcaaatccatcgatgccctgttccgtgagatatttcatacagatgtatacagaggaggg
gacgaagcatgctag

DBGET integrated database retrieval system