KEGG   Anaerostipes hadrus: CL2_24660Help
Entry
CL2_24660         CDS       T02612                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bprl  Anaerostipes hadrus
Brite
KEGG Orthology (KO) [BR:bprl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bprl01001]
    CL2_24660
Enzymes [BR:bprl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CL2_24660
Protein kinases [BR:bprl01001]
 Serine/threonine kinases: Other
  Bacterial family
   CL2_24660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like Haspin_kinase Kdo Seadorna_VP7 APH DUF4448
Motif
Other DBs
NCBI-ProteinID: CBL39311
UniProt: D4MV95
LinkDB All DBs
Position
2458640..2460481
Genome map
AA seq 613 aa AA seqDB search
MLEIGTMLSGRYEVLKRVGSGGMADVYMAKDHKLNRNVAVKVLKSEYVEDEKFLKKFETE
AQAVARLSHPNIVNVYDVGIEDGINYIVMELAEGMTLKEYIRRKGYLSPKETVEISLQIA
SAISHAHKNHIIHRDIKPQNILVSEIGNVKVTDFGIAKATSSNTVTSTATAMGSVHYISP
EQAKGRFCDEKSDIYSLGITMYEMVTGHVPFDHENGVTIALMHLQNEITPPSQIRDGIPD
SLEKIILKCTMKKPEDRYQTADELIADLKLVFEDTSGEYVGIVPTIDDSPTIMIDQNELT
QRIQTNDDTQPVEDSDSNAYLEEDDEEEETGMNSKIEKLVIVLAAVVGAIILISIVVFVV
KSSGLFKSGKSTTQSTIAATTEAKHHNTTEKYTVDNYIGLSLEAAREAIDNKFKINVTEE
YSDTYAKGLVMQQDPESDTELEEGKTIKLVVSKGQKIEDKVSVPDVRSKTKSGAQSELKA
AGLKVSIKEAYSDDVAKGEVISQTPSHGSKVSKNTTVVITVSKGKKEDQTVSVPNLRYYT
ESEASQELQRFGLSLGSVLTEYSDSVEKGLVIRQRISSGSKVKKGTAVGIYVSLGPRQTA
TTADEESTTTDEE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgttagagattggcacgatgctgtcaggccgttatgaagtgctaaagcgcgttggaagc
ggtggaatggcagacgtttatatggcgaaagatcataaattaaaccggaacgtcgcagtg
aaggttttaaaaagtgaatacgtagaagatgagaaatttttaaagaaattcgagacagag
gcacaggcagttgcaaggctgtctcatcctaatatcgtgaatgtatacgatgttggaatt
gaagatgggatcaattatattgttatggagcttgcagaagggatgactctgaaagaatat
atccgaagaaaagggtatttatctccgaaggagacggtagagatttccctgcagatcgcg
tcagcgatctcacatgcccataagaatcatattattcatagagatattaaaccacagaat
attttagtttcagagattggtaatgtaaaggtcacagactttggaattgcgaaggcaaca
agcagcaataccgttacatcaacagcaacagcgatgggatctgtgcattacatttctcca
gaacaggcaaaaggaagattctgtgatgaaaaaagtgatatttattctttaggtatcacg
atgtatgagatggtaacaggacatgtgccatttgatcatgaaaatggtgtaacgatcgca
ttgatgcatctgcaaaatgagatcacaccgccaagtcagatcagagatggaattccagac
agtttagagaagatcattttaaaatgtacaatgaagaagccagaagaccgctatcagaca
gcagatgaattgatcgcagatctgaaactcgtgtttgaagatacttctggtgaatatgtg
ggaattgttccaacgatcgatgattctccaacgatcatgatcgatcagaacgaactaaca
cagagaatccagacaaatgatgacacacagcctgtggaagattcagatagcaatgcatat
ctggaagaggatgatgaggaagaagaaacaggaatgaactcaaagatcgagaaacttgtc
attgttcttgcagcagtggtaggtgcgatcattttgatttctattgtcgtatttgttgtc
aaaagttctggattattcaaatcaggaaaatcaacaacacaaagtacaatcgcagcaaca
acagaagccaaacatcacaatactacagaaaaatacacagttgataattatatcggattg
tctttagaagcagctagagaggcgattgataacaagttcaagatcaacgtgacagaagaa
tattccgatacgtatgcaaaaggactggtcatgcagcaagatccagaaagcgatacggaa
ttagaagaaggaaaaacgatcaagttagttgtgagcaaaggacagaagattgaagataaa
gtttcagtacctgatgtgcgaagtaagacgaagtctggtgcacagagtgaattaaaagca
gcaggactcaaagtctcaataaaagaagcttacagtgatgatgttgcgaaaggagaagtt
atctctcagactccatcacatggaagtaaagtttcgaaaaatacaactgttgtgatcaca
gtcagcaaaggcaagaaggaagatcagacggtcagcgttccaaatcttcgttattacacg
gaatctgaagcaagtcaggaactgcaaagattcggattatcattgggaagtgttttaaca
gaatatagtgacagtgtggaaaaaggacttgtcattcgtcagaggatcagttctggaagc
aaggttaagaagggaacagccgttgggatctatgtcagtcttggacctcgtcagacagcg
acaacagcggatgaagaatcaacaacaacagatgaagaataa

DBGET integrated database retrieval system