KEGG   Butyrate-producing bacterium SM4/1: CL3_10130Help
Entry
CL3_10130         CDS       T02610                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
bprm  Butyrate-producing bacterium SM4/1
Brite
KEGG Orthology (KO) [BR:bprm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bprm03012]
    CL3_10130
   03029 Mitochondrial biogenesis [BR:bprm03029]
    CL3_10130
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bprm04147]
    CL3_10130
Translation factors [BR:bprm03012]
 Eukaryotic Type
  Elongation factors
   CL3_10130
 Prokaryotic Type
   CL3_10130
Mitochondrial biogenesis [BR:bprm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CL3_10130
Exosome [BR:bprm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CL3_10130
  Exosomal proteins of breast cancer cells
   CL3_10130
  Exosomal proteins of colorectal cancer cells
   CL3_10130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: CBL35917
UniProt: D4MQ81
LinkDB All DBs
Position
complement(881074..882267)
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTTLTAAITKTLHDRLGTGEAVAFENIDKAPEERER
GITISTAHVEYETNNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGVMAQTREH
ILLSRQVGVPYIVVFMNKCDMVDDPELLELVEMEIRELLNEYEFPGDDTPIIQGSALKAL
EDPSSEWGDKILELMDAVDSYVPDPVRDTDKPFLMPVEDVFSITGRGTVATGRVERGTLH
VSDEVEIVGIHEETRKVVVTGIEMFRKLLDEAQAGDNIGALLRGVQRTEIQRGQCLCKPG
SVKCHNKFTAQVYVLTKDEGGRHTPFFNNYRPQFYFRTTDVTGVCELPAGTEMCMPGDNV
EMTVELIHPVAMEQGLRFAIREGGRTVGSGRVVSILE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagcaaagtttgaaagaactaaaccacattgcaacattggtaccatcggacac
gttgaccatggtaagacaactttaacagcagctatcacaaagactctgcatgacagatta
ggtacaggtgaggctgttgctttcgagaacatcgataaggctccagaggagagagagcgt
ggaatcactatctctacagcacacgttgagtacgagacaaacaacagacactatgcacac
gttgactgcccaggacatgctgactacgttaagaacatgatcactggtgctgctcagatg
gacggcgctatccttgtagtagctgctacagacggtgttatggctcagacaagagagcac
atccttctgtcccgtcaggtaggcgttccttacatcgttgtattcatgaacaagtgtgat
atggttgacgatccagagcttcttgagttagtagagatggagatccgtgagcttctgaac
gagtacgagttcccgggcgatgacacaccgatcatccagggttccgcattaaaggctctt
gaggatccgtccagcgagtggggagacaagatccttgagcttatggatgctgtagacagc
tatgttccggatccagttcgtgacacagataagccattccttatgccagttgaggacgta
ttctccatcacaggtcgtggtacagttgctacaggccgtgtagagcgtggtacacttcat
gtatctgatgaggttgagatcgttggtatccacgaggagacacgtaaggtagttgtaact
ggtatcgagatgttccgtaagctccttgacgaggctcaggctggtgacaacatcggtgct
ctgcttcgtggtgttcagagaacagagatccagagaggtcagtgtctgtgcaaaccaggt
tctgtaaagtgccacaataagttcacagcacaggtttacgttctgacaaaggacgagggt
ggccgtcatacaccattcttcaacaactaccgtccgcagttctacttcagaacaacagac
gttacaggtgtttgcgagttaccggctggtacagagatgtgcatgcctggcgataacgta
gagatgacagttgagctgatccatccagtagctatggagcagggacttcgtttcgctatc
cgtgagggcggccgtacagttggttccggtagagtagtttctatccttgagtaa

DBGET integrated database retrieval system