KEGG   Butyrate-producing bacterium SM4/1: CL3_32310Help
Entry
CL3_32310         CDS       T02610                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bprm  Butyrate-producing bacterium SM4/1
Brite
KEGG Orthology (KO) [BR:bprm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bprm01001]
    CL3_32310
Enzymes [BR:bprm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CL3_32310
Protein kinases [BR:bprm01001]
 Serine/threonine kinases: Other
  Bacterial family
   CL3_32310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like RIO1 APH Kdo
Motif
Other DBs
NCBI-ProteinID: CBL36982
UniProt: D4MT96
LinkDB All DBs
Position
complement(2831376..2832674)
Genome map
AA seq 432 aa AA seqDB search
MMLRPGMYLQDRYEILEQIGSGGMSEVYRAKCHKLNRLVAIKVLKEEFSSDAGFVKKFKM
EAQAAAGLSHPNIVSVYDVVDEGSIHYIVMELIEGITLKSYITKKGRLGSKEAIGIALQV
AQGIAAAHDQHIVHRDIKPQNMIISRDGKVKVADFGIARAVTTQTIGATAVGSVHYISPE
QARGGFSDSRTDIYSLGITMYEMVTGTVPFDGDNTVSIALAHLEQPITPPSRLNPEVPVS
LERIIMKCTQKKPEKRYADVYELISDLRHALVDPDDDFVAQEPEVDTSSPTMVISGDELS
QIKSAPRRSTGPIVMSGQSNSLRDVPGSGGQHERRGDREHGYDRRKEPESGRELKHSGYD
KNYDRDYERGHSGGYGRQDAAENGRDLDYDYEEDYGYDRGRSSGYGGSGSSRTLGGKKGG
RGGKSADVNPHD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttagaccgggaatgtaccttcaggatcgatatgagattcttgaacagattgga
tccggcggaatgtcagaggtctaccgggcgaagtgccacaagctcaacaggctggtggcc
atcaaggttttaaaagaagaattcagttccgacgcaggctttgtgaagaagttcaagatg
gaagcccaggcggcggcaggactctcccatccgaatattgtgagtgtctatgacgttgtg
gacgagggaagcatccattacattgtcatggagctgattgaggggatcaccttaaaaagc
tatattacgaaaaagggaaggctcggctccaaggaggccatcgggattgcgctccaggtg
gctcagggaattgcagccgcccacgatcagcatattgtccaccgggacatcaagcctcag
aatatgattatctccagggacgggaaggtaaaggtggcagattttggcattgccagggct
gtcaccacccagaccatcggggcgacggctgtgggctctgtgcactatatctcgccggag
caggcgagaggaggcttcagcgattccagaacggatatttactctcttggaattaccatg
tatgagatggtgacgggaaccgttccctttgacggagacaatacggtgagcatagcgctg
gcccatctggaacagcccatcaccccgccttccaggctgaatcccgaggtaccggtaagc
ctggagcgcattatcatgaaatgcacccagaagaagccggaaaagcggtatgcggatgtc
tatgagttgatctccgatctgcgccatgcccttgtggatccggatgacgacttcgtggct
caggagccggaggtggatacctcctcgcctacgatggtgatctccggggatgagctgagc
cagattaagagcgcgcccaggcgcagtaccggccccattgtcatgagcggccagagcaac
agtctccgggatgtgccggggtccggcggacagcatgagagaagaggagacagggagcac
ggctatgacagaaggaaggagccggaaagcggccgcgaactgaaacacagcggctatgat
aagaattatgacagagattacgagcgggggcactccggcggctacggacgccaggatgct
gcggagaacggaagggacctggactatgactatgaggaggactacggctatgacaggggc
cgcagctcaggctacggcggttccggctccagccggactttgggaggcaaaaagggcggc
agaggaggaaaaagcgcagatgtaaacccccacgattga

DBGET integrated database retrieval system