KEGG   Blautia producta: PMF13cell1_00178Help
Entry
PMF13cell1_00178  CDS       T05894                                 

Gene name
ddl_1
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpro  Blautia producta
Pathway
bpro00473  D-Alanine metabolism
bpro00550  Peptidoglycan biosynthesis
bpro01100  Metabolic pathways
bpro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PMF13cell1_00178 (ddl_1)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PMF13cell1_00178 (ddl_1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PMF13cell1_00178 (ddl_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpro01011]
    PMF13cell1_00178 (ddl_1)
Enzymes [BR:bpro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PMF13cell1_00178 (ddl_1)
Peptidoglycan biosynthesis and degradation proteins [BR:bpro01011]
 Precursor biosynthesis
  Amino acid ligase
   PMF13cell1_00178 (ddl_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK ATPgrasp_ST GARS_A ATP-grasp ATPgrasp_YheCD GSP_synth
Motif
Other DBs
NCBI-ProteinID: QBE94685
LinkDB All DBs
Position
complement(186588..187619)
Genome map
AA seq 343 aa AA seqDB search
MNIVVLAGGSSTEREVSIVSGQGICTALRRRNHKAVLVDAYFGKENWGEEMFPQTYDIDA
EIKYMQEKSGELEETMKNRKEFFGPNVLEICKAADMVFLALHGSNGEDGKVQSVFDLMGI
PYTGSGPLSSGMAMDKGITKMVFEAKGVPTPKGITLQKGKCSSELADYDMDFPVIVKPCC
GGSSVGVCIAKNQEEYEAALDESFSYENEAVVEQFVEGREFSVAVVDGKAYPVIEIAPLQ
GFYDYKNKYEAGSTIETCPAEISESLTKEMQKYAEQGYKALGLQAYGRLDFIMDKDGNMY
CLEANTLPGMTPTSLIPQEAKVLGMDYPELCEKLIEVSLKKYK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagttgttttagcaggcggcagcagtacagagagggaagtctccattgtgtcc
ggacagggcatctgcacagcgctgcgcagaagaaatcacaaagcggtactggtagacgcg
tattttggaaaagaaaactggggagaggaaatgttcccccagacctacgatatagatgca
gagattaagtatatgcaggaaaagagcggggaactggaagaaaccatgaaaaacaggaaa
gaattcttcggtcccaatgtacttgaaatctgcaaagcagcagatatggtcttcctggca
ctgcacggctcaaatggggaagatggcaaagtacagtccgtatttgatctgatgggaatt
ccctacacaggttccggtccactgagcagcggaatggccatggataagggaattacgaaa
atggtatttgaggcaaagggagtgcccactccaaaaggaattacactgcagaagggaaaa
tgcagcagtgaactggcagactatgacatggacttcccggtgatcgtgaaaccgtgctgc
ggaggctccagtgtgggtgtctgtattgccaagaaccaggaggaatatgaggcggctctt
gacgagtccttttcctatgaaaatgaagcggttgtagagcagtttgttgagggccgggag
ttctccgtggctgtagtggacggcaaggcttatccggttattgagatcgctccgcttcag
ggattttatgactataagaacaaatatgaggcaggttccaccattgagacctgtccggca
gagatttccgagtcactgaccaaggaaatgcagaaatacgcagagcagggttataaagcg
ctgggcctgcaggcctacggcagactggattttatcatggacaaagacggaaacatgtac
tgtctggaggcaaacaccctgccgggaatgacccccacaagcctgattccccaggaagca
aaagtgcttggaatggattacccggaattgtgtgagaagctcatcgaggtttctctgaaa
aaatataaatga

DBGET integrated database retrieval system