KEGG   Blautia producta: PMF13cell1_01678Help
Entry
PMF13cell1_01678  CDS       T05894                                 

Gene name
sdhA_1
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bpro  Blautia producta
Pathway
bpro00020  Citrate cycle (TCA cycle)
bpro00190  Oxidative phosphorylation
bpro00650  Butanoate metabolism
bpro01100  Metabolic pathways
bpro01110  Biosynthesis of secondary metabolites
bpro01120  Microbial metabolism in diverse environments
bpro01130  Biosynthesis of antibiotics
bpro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PMF13cell1_01678 (sdhA_1)
   00650 Butanoate metabolism
    PMF13cell1_01678 (sdhA_1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PMF13cell1_01678 (sdhA_1)
Enzymes [BR:bpro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PMF13cell1_01678 (sdhA_1)
    1.3.5.4  fumarate reductase (quinol)
     PMF13cell1_01678 (sdhA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 DAO HI0933_like Pyr_redox_2 GIDA FAD_binding_3 Pyr_redox_3 FAD_oxidored Pyr_redox Exog_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: QBE96140
UniProt: A0A4P6LY29
LinkDB All DBs
Position
1863251..1864852
Genome map
AA seq 533 aa AA seqDB search
MFTPEMLESIKKVEATRDERMGMEPRRMTADEKDALLKAYHPDYRKDGFAEIKIGPNKGQ
KAPTELSGLLHSNSRLLNVDIDLNKVDYDVDVLVIGGGGAGSSAAIEAHEAGANVMIVTK
LRIGDANTMMAEGGIQAADKENDSPVQHYLDAFGGGHFAARPELLKRLVMEAPDAIKWLN
ELGVMFDKDAEGNMVTTHGGGTSRKRMHACKDYSGAEIMRTLRDEVLNRQIPVVEFTSAV
ELIKDEKGQVAGAVLQNMETDDYMVARAKTVVIATGGAGRLHYQNFPTSNHYGATADGLV
LGYRAGAPLLYQDTIQYHPTGVAYPAQIYGALVTEKVRSLGAMLINAEGEAFMHPLETRD
VAAASIIRECSDRGKGVETPLGSGVWLDTPMIERIGGEGTIEKRIPAMLRMYMNYDIDMR
KQPILVYPTLHYQNGGLEIGGDGFTKAISNLLVAGEAVGGIHGRNRLMGNSLLDIIVFGR
NAGKAAAARAKETELGSMTLEHIEKYAEELKNAGIASDDVSPLLLPKYARHER
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaccagaaatgcttgagtccatcaaaaaggtggaagctaccagagacgagcgt
atgggcatggaacccagacgtatgactgctgatgaaaaagatgctctcttaaaggcttat
catcctgattacagaaaagacggttttgcggagatcaagatcgggccaaacaaaggccag
aaggcacctacagagctgagcggtcttctccactccaacagccgtctgttaaatgtagat
attgatctgaataaagtagattatgatgtggatgtgctggtgatcggcggcggcggagcc
ggttcttccgcagccatcgaggctcacgaagccggagccaatgtcatgatcgtgacaaag
ctgcgtatcggtgatgccaacacgatgatggcagagggcggtatacaggctgctgacaaa
gagaacgattccccggttcagcattatcttgatgcgttcggcggcggccactttgcagca
agaccggagctgttgaaaagactggtcatggaagcaccggacgccattaaatggctgaat
gaactgggtgtaatgtttgacaaagacgcagagggcaatatggtgacaacccacggcggc
ggaacatccagaaagagaatgcatgcctgcaaggattactccggtgcagagatcatgcgt
acactccgcgatgaggtgctgaatcgacagatccccgttgtggaatttacatctgcagtg
gagctgatcaaagatgagaagggtcaggtggcaggtgctgttcttcagaacatggagaca
gatgattacatggtggcaagagccaaaacagtagttatcgccacaggcggagcaggccgt
ctccactatcagaatttcccgacctccaaccactatggcgcaacggctgacggacttgtt
ctgggataccgcgcaggcgctccccttttatatcaggatacgattcagtatcaccccaca
ggcgttgcctatccggcacagatttacggtgcgcttgttacagagaaagtccgttctctg
ggcgctatgctgatcaatgcagagggtgaggcattcatgcatcctcttgagacccgtgat
gttgccgctgcgtctattatccgcgagtgcagtgacaggggaaaaggcgttgagacgcct
ctgggcagcggtgtatggctggatactcccatgatcgagaggatcggcggagaaggaact
attgaaaaacgtattcctgccatgcttcgtatgtacatgaattacgatattgatatgaga
aaacagcctattcttgtatatccaactcttcattaccagaacggcggtctggaaatcggc
ggagacggatttacaaaggcgatcagcaacctgctggtagcaggagaagccgtgggagga
atccacggaagaaaccgtctgatgggcaattctcttctggatattattgtattcggccgt
aatgcaggtaaggcagcggcagccagagcaaaagagacagaacttggctctatgacactg
gagcatattgaaaaatatgcagaggaactgaaaaacgcaggcattgcttccgatgatgta
tctccattattgcttcctaagtatgcccgtcatgaaagataa

DBGET integrated database retrieval system