KEGG   Butyrate-producing bacterium SS3/4: CK3_13530Help
Entry
CK3_13530         CDS       T02611                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
bprs  Butyrate-producing bacterium SS3/4
Brite
KEGG Orthology (KO) [BR:bprs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bprs03012]
    CK3_13530
   03029 Mitochondrial biogenesis [BR:bprs03029]
    CK3_13530
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bprs04147]
    CK3_13530
Translation factors [BR:bprs03012]
 Eukaryotic Type
  Elongation factors
   CK3_13530
 Prokaryotic Type
   CK3_13530
Mitochondrial biogenesis [BR:bprs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CK3_13530
Exosome [BR:bprs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CK3_13530
  Exosomal proteins of breast cancer cells
   CK3_13530
  Exosomal proteins of colorectal cancer cells
   CK3_13530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: CBL41068
UniProt: D7GTC6
LinkDB All DBs
Position
1368951..1370144
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTTLTAAITKVLAARVAGNTAENFEDIDKAPEERER
GITISTAHVEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGVMAQTREH
ILLSRQVGVPYIVVFMNKCDMVDDPELLELVEMEIRDLLNEYEFPGDDTPIIQGSALKAL
EDPNGEWGDKIMELMDAVDSYIPDPVRDTDKPFLMPIEDVFTITGRGTVATGRVERGTLK
LNDEVEIVGIHEETRKTVVTGIEMFRKLLDQAQAGDNIGALLRGVQRTEIQRGQCLVKPG
SVTCHKKFTAQVYVLTKDEGGRHTPFFNNYRPQFYFRTTDVTGVCELPEGTEMCMPGDNV
EMTIELIHPVAMEQGLRFAIREGGRTVGSGRVATIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagctaagtttgaaagaaccaaaccgcattgtaacattggtaccattggacac
gttgaccatggtaaaacaacattaacagcagcaatcacaaaagttcttgcagcaagagtt
gcaggtaacacagctgagaactttgaagatatcgataaagctccggaagagagagaacgt
ggtatcacaatctccacagctcacgttgagtatcagacagagaagagacactatgcacac
gttgactgcccaggccatgctgactatgtaaagaacatgatcactggtgctgctcagatg
gatggtgctatcctcgttgtagctgctactgatggtgttatggctcagacaagagagcac
atcctgctttcccgtcaggtaggcgtaccgtacatcgtagtattcatgaacaagtgcgat
atggttgacgatccggagcttcttgagctcgtagagatggagatcagagatcttcttaac
gagtacgagttcccgggcgatgacactccgatcatccagggttccgctcttaaggctctt
gaggatccgaacggtgagtggggcgacaagatcatggaacttatggacgctgtagatagc
tacattccggatccggttcgtgacacagataagccgttccttatgccgatcgaggatgta
ttcacaatcacaggtcgtggtacagttgctacaggccgtgtagagcgtggtactcttaaa
ctcaacgatgaggttgagatcgttggtattcacgaggagactcgtaagacagttgtaact
ggtatcgagatgttccgtaagctccttgaccaggctcaggctggtgataacatcggtgct
cttcttcgtggtgttcagagaacagagatccagagaggtcagtgtcttgttaaaccgggt
tccgtaacctgccacaagaaattcacagctcaggtttatgttcttactaaagacgagggt
ggtcgtcatacaccgttctttaacaactatcgtccgcagttctacttcagaacaacagac
gttacaggcgtttgcgagcttccggaaggtacagagatgtgcatgccgggcgacaacgtt
gagatgacaatcgagcttatccatccggtagctatggagcagggtcttcgtttcgctatc
cgtgagggcggcagaactgttggttccggtagagttgctacaatcatcgagtaa

DBGET integrated database retrieval system