KEGG   Butyrate-producing bacterium SS3/4: CK3_27480Help
Entry
CK3_27480         CDS       T02611                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bprs  Butyrate-producing bacterium SS3/4
Pathway
bprs00970  Aminoacyl-tRNA biosynthesis
bprs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bprs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CK3_27480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bprs03029]
    CK3_27480
Enzymes [BR:bprs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CK3_27480
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CK3_27480
Mitochondrial biogenesis [BR:bprs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CK3_27480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: CBL42264
UniProt: D7GWS2
LinkDB All DBs
Position
2768647..2770080
Genome map
AA seq 477 aa AA seqDB search
MKQYETVIGLEVHVELATKTKIFCGCKTDFGAAPNTHVCPICTGMPGSLPILNKQVVEFA
LRAGLALNCQINQFCKFDRKNYFYPDNPQNYQISQLYLPICHDGYVELETAAGTKRIGIH
EIHMEEDAGKLVHDEWTDSSLVDYNRSGVPLIEIVSEPDMRSADEVIQYLEHLQSTMQYL
GVSDCRLQEGSMRADVNLSVREVGSPVFGTRTEMKNLNSFKAIAHAIEGERERQIELLED
GRAVVQETRRWDDNKESSHAMRSKEDAKDYRYFPDPDLPPIDISDAWIASIRAAQPELKK
AKSRRYQSEYGLSAYDADILTGDKALAELFENTIKAGAAPKKAANWLTGETLRLLKEKES
EASKITFTAEHLASLIALLEKSVINNQTAKDVFAVMFESDVDPAAYVEEHGLRMESDSGL
LEETVKKILDANPKAVGELKEGKDKVIGFLLGQVMKEMKGKANPSQVSGMIHKLVQE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtatgaaaccgtcatcggtcttgaggtccatgtggagttagccacaaagacg
aaaattttctgcggatgcaaaacagatttcggcgcagcgccgaacacccatgtctgcccg
atctgtacgggtatgccgggatctcttcctatattaaataagcaggtcgtggagttcgca
cttcgcgcgggccttgctttaaactgccagatcaaccagttctgcaagtttgaccgtaag
aactacttctacccggataacccacagaactaccagatctcccagttatatctgccgatc
tgccacgacggttatgtggagcttgagacggcagctggaacaaagcgcatcggcatccat
gagattcatatggaggaggatgcgggaaagctggttcatgacgagtggaccgacagttcc
ctggtcgattacaaccgaagcggcgttccactgattgagatcgtatccgaaccggatatg
agaagcgccgatgaggtcatccagtacttagagcatcttcagtccaccatgcagtacctc
ggcgtttccgactgccgtctccaggaaggttccatgcgtgccgacgtaaacctttctgtc
cgcgaggtgggaagcccggtatttgggacgagaactgagatgaagaacttaaactccttc
aaggccattgcccatgccatcgagggagaaagagagcgccagatagagcttcttgaggat
ggtcgtgctgttgtccaggagacacggcgctgggatgacaacaaggaatcttcccatgcg
atgcgttccaaggaagacgcgaaggactaccgttacttcccggacccggatcttccgccg
atcgatatttccgacgcatggatcgcttccatccgtgcagctcagccggagttaaagaaa
gcaaaatccaggagataccagtccgagtacgggctgagtgcttatgatgcggatatcctc
acaggggataaggcgctggctgaacttttcgagaacaccatcaaggcaggtgcggcaccg
aagaaggcagcgaactggctgaccggcgagacgcttcgtcttttaaaggagaaggaatca
gaggcatcgaagatcaccttcacagcagagcatctggcatctcttatcgcactccttgag
aagagcgtcatcaacaaccagactgcaaaggatgtgtttgctgtcatgtttgagtctgat
gtggatccggcagcttatgttgaggaacatggactcaggatggagagtgattccggactt
ctggaggaaacagtgaagaagatcctggacgcaaacccgaaagctgtgggcgagttaaaa
gaaggaaaagacaaagtcatcggattcctcttgggacaggtcatgaaggagatgaaagga
aaagcaaacccgtcacaggtgagcgggatgatccataaacttgtgcaggaataa

DBGET integrated database retrieval system