KEGG   Butyrate-producing bacterium SS3/4: CK3_28640Help
Entry
CK3_28640         CDS       T02611                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bprs  Butyrate-producing bacterium SS3/4
Brite
KEGG Orthology (KO) [BR:bprs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bprs01001]
    CK3_28640
Enzymes [BR:bprs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CK3_28640
Protein kinases [BR:bprs01001]
 Serine/threonine kinases: Other
  Bacterial family
   CK3_28640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo Haspin_kinase RIO1 Kinase-like APH
Motif
Other DBs
NCBI-ProteinID: CBL42368
UniProt: D7GX26
LinkDB All DBs
Position
complement(2886780..2888954)
Genome map
AA seq 724 aa AA seqDB search
MILYPGTMLQDRYEILEKIGSGGMSEVYKAKCHKLNRLVAIKVLKSEFTSDATFVSKFKM
EAQAAAGLSHPNIVNIYDVVDEGDIHFIVMELVEGITLKSYITKKGHLDVKEAIGIAIQV
ASGIEAAHEQHIIHRDIKPQNMLISMDGKVKVADFGIARAVSSQTMNAATVVGSVHYISP
EQARGGYSDERSDLYSLGITMFEMVTGHVPFEGDNTVTVALAHLEEPMPDPRMLNPDVSP
SLARIILKCTEKRPERRYPNAAAVISDLRRALLNDDDPTIGAVKEEDHSSDTIVISPKEL
NLIKTRSGERIRESKPVKEIRERRERRDLEKRYDQTDNAKKEPKKNKVDDEATGLEKILT
GLGVAAAIVIVAVVIVFVLKLGGLFRSSTPEDPTKTVSEEAMTEEAKTTAASETVISQKE
VYMPKLVGHSEEEAEKILQGLDLTMQVEQKNSDEVEKGIVISQKEEPDTVIPRFSKVTVV
ISAGSDKVDLSELGLSGMTLETAVRLLEGKNLKADVREEASEEVASGTIIRYEPEEKVAL
GSTVTLYVSTGPEEEFVPVPNLYGKTDAEAAALLSAAGLVTGEVSKEYDSTISAGHVISQ
GVEAGTQVAPGDTVDYTLSLGPEAPKKQFIASLDASYPLQVSYGPGAASSEIQILIRLKQ
TVNGKVTYTKLAEPKSYSADTTLNIKLDRIRGADGVQTGEVEIVDLTNNVVLTSYNVTFT
EVDG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgattttataccctggaacgatgctgcaggaccgatatgagattctggaaaagataggt
tccggcggaatgtcagaggtctataaagcaaaatgccataaattaaaccgtctggtcgcg
atcaaggtactgaaatcggagtttacttccgacgcgacctttgtcagtaaatttaagatg
gaagctcaggcagcggccggactttcacacccgaatattgtcaatatatatgatgtcgtg
gatgagggagacatccactttatcgttatggagctcgtagagggaatcaccttaaagagc
tatatcacgaaaaaaggtcatttggatgtaaaggaagccatcgggatcgcgatccaggta
gcctccggaatcgaagcagcccatgaacagcatatcattcaccgtgatatcaagcctcag
aatatgctgatctccatggatggaaaggtgaaggtagcggacttcggaattgcgagagct
gtgtcgtcccagactatgaatgcggcgacagttgtgggatctgtccactatatctccccc
gaacaggcgagaggcggatacagcgatgagcggagcgacctgtattccttaggtatcacc
atgtttgagatggtcaccggccatgttccgtttgagggggacaacacggtgacggtcgcg
ctggcacatctggaagaaccgatgccggatcccagaatgttgaatccggatgtgtcccca
agtcttgcgaggatcatcttaaaatgtacggaaaagagaccggagcgccgatacccgaac
gcggcggctgtgatcagtgacctgagaagagcactcttaaatgatgacgacccgactatc
ggcgccgttaaagaggaagaccacagctccgataccatcgtcatcagcccaaaagaactg
aatctgatcaagacgagaagtggggaacggatccgggagtcaaagccggtaaaagagatc
cgtgagcgcagggaacggcgggatctggaaaagcggtatgatcagacagacaacgcgaag
aaggaaccgaaaaagaataaagtggatgatgaagccacaggactggaaaagatcctgaca
ggcctgggcgtggcggcagccatcgtcattgtcgcggttgtgatcgtgtttgttctgaag
cttggcggtctgttcagaagcagcactccggaggatccgacaaaaaccgtttctgaggaa
gctatgacggaagaagcgaagacaactgcggcatcggagactgttatcagccagaaggaa
gtctatatgccgaagcttgtgggccactccgaggaggaagccgagaagatcttacaggga
ctagatctcaccatgcaggtagagcagaaaaactcggatgaagtggaaaaaggcatagtc
atctcacagaaggaagagcccgataccgtgattccgcgtttctccaaggtaaccgttgtc
atcagcgcgggttctgataaggttgatctctcagaacttggcctttccggaatgacactg
gaaacggcggtccgcctgttggagggaaagaatttaaaagcagatgttcgggaggaagcc
agcgaggaggtggcttccggaacgatcatccgctatgaaccggaggaaaaagtggccctc
ggaagtaccgtaaccttatatgtgagtacgggaccggaggaggaattcgttcctgtaccg
aatctttatggaaagacggacgcggaggcggcagcacttctttccgcggcaggacttgtg
accggagaggtttcaaaggagtacgacagcacgatctcggccggtcacgtcatcagtcag
ggcgttgaggcaggaactcaggtagcacctggggataccgtggattacactctgagtctt
gggccggaagctccgaaaaaacagtttatcgcgtctctggatgcaagctatccgcttcag
gtctcctatggaccgggggcagcatcctccgagatccagatcctgatccgtttaaagcag
acggtgaacggcaaagtgacctatacgaagcttgcggagccaaagtcttacagcgcggac
acaaccctgaatatcaagttagacaggatccgcggcgcggacggcgtgcagaccggtgag
gtggagatcgtggacctcacgaacaacgtggtactgacatcctataatgtgacatttacg
gaggttgacggttga

DBGET integrated database retrieval system